Recombinant Ralstonia pickettii NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please specify this during your order; we will prioritize your request.
Synonyms
nuoA; Rpic_2214; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Ralstonia pickettii (strain 12J)
Target Names
nuoA
Target Protein Sequence
MNLEAYFPVLLFIVVGVGLGLALMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVR YYLIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four protons across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ralstonia pickettii and why is it significant for research?

Ralstonia pickettii is a gram-negative bacillus that has been identified as the most critical clinical pathogen of the genus Ralstonia. This organism demonstrates exceptional adaptability to extreme environmental conditions, particularly in drinking water systems, while also being capable of causing numerous harmful infections in humans .

From a research perspective, R. pickettii presents a valuable model organism for several reasons:

  • It possesses an open pan-genome with significant genetic plasticity (35.1% core-genome, 64.9% accessory genome)

  • It harbors diverse mobile genetic elements that facilitate adaptation

  • It has developed mechanisms for survival in drinking water environments

  • It contains virulence-related elements associated with macromolecular secretion systems

R. pickettii has been isolated from various clinical specimens including blood, urine, and cerebrospinal fluid, and has been associated with nosocomial outbreaks caused by contaminated solutions used for patient care . The dual nature of R. pickettii—as both a pathogen and an environmentally adaptable organism—makes it an important subject for multidisciplinary research spanning clinical microbiology, environmental science, and molecular biology.

What is the function of NADH-quinone oxidoreductase in bacterial metabolism?

NADH-quinone oxidoreductase (EC 1.6.99.5), also known as Complex I or NADH dehydrogenase I, plays a central role in the respiratory chain of Ralstonia pickettii and other bacteria . This enzyme complex performs several critical functions:

  • Electron transport: It catalyzes the transfer of electrons from NADH to quinone, representing the entry point of electrons into the respiratory chain.

  • Energy conservation: During electron transfer, it contributes to creating a proton gradient across the bacterial membrane, which drives ATP synthesis.

  • Redox homeostasis: The enzyme helps maintain the NAD+/NADH ratio in the cell, which is essential for various metabolic pathways.

  • Environmental adaptation: In organisms like R. pickettii that can survive in nutrient-limited environments, NADH-quinone oxidoreductase may have evolved specialized mechanisms for energy efficiency.

The NADH-quinone oxidoreductase complex typically consists of multiple subunits organized into a membrane domain and a peripheral arm. The membrane domain, which includes subunit A (nuoA), is involved in proton translocation across the membrane, while the peripheral arm contains the NADH binding site and electron transfer components .

What experimental design considerations are essential when studying recombinant nuoA protein?

When designing experiments to study recombinant Ralstonia pickettii NADH-quinone oxidoreductase subunit A (nuoA), researchers must address several critical considerations:

  • Design structure selection:

    • For hypothesis testing, use experimental designs with manipulation of independent variables

    • For exploratory studies of protein characteristics, nonexperimental designs may be appropriate

    • Consider whether comparative design (comparing different variants) or correlational design (examining relationships between variables) is more suitable

  • Expression system optimization:

    • Selection of host organism (E. coli strains optimized for membrane proteins)

    • Vector design (promoter strength, tag placement, fusion partners)

    • Induction conditions (temperature, inducer concentration, duration)

    • Codon optimization for expression host

  • Independent and dependent variable definition:

    • Clearly identify independent variables (factors being manipulated)

    • Define measurable dependent variables (outcomes)

    • Control for confounding variables that might affect results

  • Control sample design:

    • Include proper negative controls (empty vector, inactive mutants)

    • Use appropriate positive controls (native protein, related proteins with known activity)

    • Design controls for each experimental step (expression, purification, activity assays)

  • Statistical considerations:

    • Determine appropriate sample sizes based on expected effect sizes

    • Plan for technical and biological replicates

    • Select appropriate statistical tests for data analysis

    • Consider randomization and blinding where applicable

  • Validation strategies:

    • Multiple complementary techniques to confirm findings

    • Orthogonal approaches to measure the same parameter

    • Controls for systematic errors in each technique

When studying membrane proteins like nuoA, researchers should recognize the limitations of studying an isolated subunit that normally functions as part of a multi-subunit complex. Complementary approaches, such as reconstitution experiments with other subunits, may provide more comprehensive insights.

How should researchers approach comparative studies of NADH-quinone oxidoreductase across different Ralstonia species?

Comparative studies of NADH-quinone oxidoreductase across different Ralstonia species require a structured experimental design that accounts for both genetic and functional variations:

  • Study design framework:

    • Implement a nonexperimental comparative design approach

    • Examine differences between two or more groups (species or strains)

    • Consider both genetic (sequence, structure) and phenotypic (activity, regulation) comparisons

  • Species and strain selection:

    • Include type strains and environmentally or clinically relevant isolates

    • Consider R. pickettii alongside related species like R. mannitolilytica and R. insidiosa

    • Ensure accurate species identification using multiple methods (16S rDNA sequencing, specific PCR)

  • Genetic analysis components:

    • Sequence the nuoA gene and surrounding regions

    • Perform phylogenetic analysis to establish evolutionary relationships

    • Analyze operon structure and genetic context

    • Identify conserved and variable regions

  • Functional characterization:

    • Standardize protein expression and purification methods across species

    • Use identical assay conditions for activity measurements

    • Measure multiple parameters (NADH oxidation, quinone reduction, proton translocation)

    • Test activity under various conditions (pH, temperature, substrate concentrations)

  • Data analysis approach:

    • Use appropriate statistical methods for comparative data

    • Apply multivariate analysis to identify patterns across species

    • Correlate genetic differences with functional variations

Table 1. Example comparative analysis framework for nuoA across Ralstonia species

SpeciesStrain IDnuoA Sequence Identity (%)NADH Oxidation (μmol/min/mg)Quinone Reduction (μmol/min/mg)Environmental Source
R. pickettii12J100 (reference)[measured value][measured value]Reference strain
R. pickettiiClinical isolate[% identity][measured value][measured value]Blood culture
R. pickettiiEnvironmental[% identity][measured value][measured value]Drinking water
R. mannitolilyticaType strain[% identity][measured value][measured value]Reference strain
R. insidiosaType strain[% identity][measured value][measured value]Reference strain

This approach allows researchers to systematically investigate how NADH-quinone oxidoreductase varies across the Ralstonia genus and correlate these differences with ecological niches or pathogenic potential .

What controls are critical for validating recombinant nuoA protein expression and function?

Rigorous experimental controls are essential when working with recombinant nuoA protein to ensure valid and reproducible results:

  • Expression controls:

    • Non-induced vs. induced cultures to verify expression

    • Time-course sampling to determine optimal expression time

    • Fractionation controls to confirm membrane localization

    • Western blot with anti-tag or specific antibodies to verify identity and integrity

  • Purification controls:

    • Samples from each purification step to assess purity and yield

    • Empty vector processed in parallel to identify non-specific contaminants

    • Mass spectrometry validation of purified protein

    • Negative control purifications from non-expressing cells

  • Functional controls:

    • Denatured protein control (heat-inactivated or chemically denatured)

    • Site-directed mutants of conserved residues

    • Native complex or well-characterized homologous proteins as positive controls

    • Buffer-only reactions to establish baseline measurements

  • Reconstitution controls:

    • Lipid-only controls when performing membrane reconstitution

    • Detergent concentration controls to assess detergent effects

    • Mixed reconstitution with other subunits to assess complex formation

  • Activity assay controls:

    • Substrate specificity controls (alternative electron donors/acceptors)

    • Known inhibitors of NADH-quinone oxidoreductase

    • Environmental condition controls (pH, temperature, ionic strength)

    • Time course measurements to ensure linearity of enzyme activity

Table 2. Essential controls for recombinant nuoA protein experiments

Experimental StageControl TypePurposeExpected ResultInterpretation if Different
ExpressionEmpty vectorBackground proteinsNo nuoA bandExpression system contributes similar-sized proteins
Non-inducedLeaky expressionMinimal/no nuoAConstitutive expression occurs
PurificationWestern blotIdentity confirmationBand at expected sizeDegradation or aggregation
Negative control purificationNon-specific bindingNo proteinPurification method captures contaminants
ActivityDenatured proteinNon-specific activityNo activityActivity is not enzyme-specific
Known inhibitorMechanism verificationDose-dependent inhibitionDifferent mechanism than expected
pH seriesOptimal conditionsBell-shaped curveAltered pH dependence
ReconstitutionDetergent-onlyMicelle effectsNo activityDetergent interferes with assay

This systematic approach to controls helps distinguish genuine nuoA expression and activity from artifacts and provides a framework for troubleshooting if expected results are not observed .

How can genomic analysis elucidate the evolution of nuoA in Ralstonia pickettii?

Genomic analysis offers powerful approaches to understand the evolution of nuoA in Ralstonia pickettii within the broader context of bacterial respiratory systems:

  • Pan-genome analysis:

    • Compare nuoA sequences across the R. pickettii pan-genome

    • Determine whether nuoA belongs to the core genome (present in all strains) or accessory genome

    • Analyze sequence conservation patterns within the species

    • The pan-genome analysis of R. pickettii reveals high genetic plasticity, with the core-genome representing only 35.1% of gene families

  • Phylogenetic analysis:

    • Construct phylogenetic trees using nuoA sequences from diverse bacterial phyla

    • Compare nuoA gene trees with species trees to identify horizontal gene transfer events

    • Apply molecular clock analyses to estimate divergence times

    • Use the R. pickettii phylogenetic grouping system identified in genomic studies

  • Mobile genetic element association:

    • Examine the presence of genomic islands (GIs) near nuoA

    • Identify potential horizontal gene transfer events involving respiratory chain components

    • R. pickettii genomes contain on average 17.3 ± 8 genomic islands and 1078.3 ± 34.5 horizontally transferred genes

  • Selective pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive or purifying selection

    • Compare selection patterns between R. pickettii lineages from different environments

    • Link selection patterns to known functional domains

  • Environmental adaptation correlation:

    • Compare nuoA sequences between clinical and environmental isolates

    • Identify potential adaptive mutations related to specific environmental challenges

    • Analyze convergent evolution patterns in bacteria from similar environments

Table 3. Genomic features potentially influencing nuoA evolution in R. pickettii

Genomic FeatureObservation in R. pickettiiPotential Impact on nuoA Evolution
Pan-genome structureOpen pan-genome with large accessory component Allows acquisition of new genetic variants
Mobile genetic elementsAverage 17.3 ± 8 genomic islands per genome Facilitates horizontal gene transfer
Functional enrichmentCore-genome enriched in energy production categories nuoA likely under strong purifying selection
Genetic plasticityExtensive genomic rearrangements May affect operon structure and regulation
Environmental adaptationSpecific adaptive genes in drinking water isolates May drive selection for energy efficiency

The genomic analysis of R. pickettii reveals that environmental pressures have driven adaptive evolution, leading to the accumulation of unique mutations in key genes related to metabolism . These adaptations likely extend to the NADH-quinone oxidoreductase complex, enabling R. pickettii to thrive in diverse environments including oligotrophic drinking water systems.

What approaches can elucidate structure-function relationships in R. pickettii nuoA?

Investigating structure-function relationships in R. pickettii nuoA requires integrating multiple methodological approaches to overcome the challenges inherent in studying membrane proteins:

  • Structural prediction and modeling:

    • Homology modeling based on structures of related proteins

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations to predict flexibility and conformational changes

    • Integration of experimental constraints (crosslinking, spectroscopy) into models

  • Mutagenesis strategies:

    • Alanine scanning of conserved residues

    • Targeted mutation of predicted functional sites

    • Domain swapping between homologous proteins

    • Conservative vs. non-conservative substitutions to test structural vs. functional roles

  • Biophysical characterization:

    • Circular dichroism to assess secondary structure content

    • Fluorescence spectroscopy to monitor tertiary structure changes

    • Thermal stability assays under varying conditions

    • Limited proteolysis to identify structured domains

  • Functional correlation:

    • Activity assays of wild-type and mutant proteins

    • Proton translocation measurements in reconstituted systems

    • Electron transfer kinetics using rapid mixing techniques

    • Inhibitor binding studies to identify functional sites

  • Complementation studies:

    • Gene knockout and complementation in R. pickettii

    • Heterologous expression in model organisms

    • Chimeric proteins to map functional domains

    • In vivo activity measurements under different environmental conditions

Table 4. Structure-function analysis approaches for nuoA

The challenges in analyzing membrane proteins are significant but can be addressed through complementary approaches. For example, the "had" operon from R. pickettii DTP0602 has been successfully studied using a combination of sequence analysis, heterologous expression, and activity assays to elucidate enzyme functions and interactions .

How does environmental adaptation in R. pickettii influence nuoA expression and function?

R. pickettii demonstrates remarkable adaptability to diverse environments, including drinking water systems, which likely involves adaptations in energy metabolism components such as NADH-quinone oxidoreductase. Here's a methodological framework to investigate these adaptations:

  • Transcriptional regulation analysis:

    • Compare nuoA expression levels between environmental and clinical isolates

    • Measure expression under different conditions (nutrient limitation, oxidative stress, temperature)

    • Identify transcription factors and regulatory elements controlling nuoA expression

    • Correlate expression patterns with specific environmental adaptations

  • Comparative functional analysis:

    • Compare enzyme kinetics of nuoA-containing complexes from different R. pickettii isolates

    • Assess activity under conditions mimicking environmental niches

    • Measure substrate specificity differences between environmental and clinical isolates

    • Determine energy efficiency parameters under varying conditions

  • Genetic adaptation mapping:

    • Identify mutations in nuoA sequences from environmentally diverse isolates

    • Map mutations onto structural models to predict functional impacts

    • Perform site-directed mutagenesis to recreate and test adaptations

    • Analyze coevolution of nuoA with other respiratory complex components

  • Environmental stress response:

    • Investigate nuoA expression and function under drinking water disinfection conditions

    • Test protein stability in oligotrophic environments

    • Assess activity during biofilm formation vs. planktonic growth

    • Measure responses to oxidative stress typical of water treatment

  • Experimental evolution approaches:

    • Subject R. pickettii to controlled laboratory evolution under defined conditions

    • Track genetic and expression changes in nuoA over time

    • Test evolved strains for improved fitness in specific environments

    • Correlate adaptive mutations with functional changes

Table 5. Potential environmental adaptations affecting nuoA in R. pickettii

Environmental FactorGenomic EvidencePredicted Impact on nuoAExperimental Approach
Nutrient limitationEnrichment of metabolism genes Increased efficiency of electron transportGrowth yield measurements with limited carbon sources
Oxidative stressSpecific adaptive genes Modified redox interaction with electron carriersActivity under hydrogen peroxide challenge
Biofilm formationGenomic islands with attachment factors Coordinated expression with biofilm developmentBiofilm vs. planktonic expression comparison
Temperature fluctuationMutations in metabolic genes Structural adaptations affecting stabilityTemperature-dependent activity profiling
Drinking water environmentGroup-specific functional enrichment Energy conservation adaptationsComparative genomics between water isolates

Genomic analysis of R. pickettii has revealed that strains associated with drinking water environments form distinct phylogenetic groups with specific functional enrichment patterns . These adaptations likely involve respiratory chain components like nuoA, enabling efficient energy metabolism under the oligotrophic conditions found in water distribution systems.

What are the optimal approaches for purifying recombinant nuoA while maintaining native conformation?

Purifying membrane proteins like recombinant nuoA while preserving their native conformation requires specialized techniques. Here's a methodological framework for effective purification:

  • Expression system optimization:

    • Use specialized E. coli strains designed for membrane protein expression

    • Optimize induction conditions (lower temperature, reduced inducer concentration)

    • Consider fusion partners to enhance solubility and folding

    • Control expression rate to allow proper membrane insertion

  • Membrane extraction strategies:

    • Use gentle cell disruption methods to preserve membrane integrity

    • Employ differential centrifugation to isolate membrane fractions

    • Consider selective membrane solubilization techniques

    • Optimize buffer conditions to stabilize membrane proteins

  • Detergent selection:

    • Screen multiple detergent classes (non-ionic, zwitterionic, etc.)

    • Maintain detergent above critical micelle concentration throughout purification

    • Consider mixed detergent approaches for optimal solubilization and stability

    • Implement detergent exchange protocols during purification

  • Alternative solubilization approaches:

    • Evaluate amphipols for replacing detergents after initial extraction

    • Consider nanodiscs for a more native-like membrane environment

    • Test styrene maleic acid lipid particles (SMALPs) for direct extraction with native lipids

    • Assess saposin-lipoprotein nanoparticles for stabilization

  • Chromatographic strategy:

    • Use affinity chromatography (e.g., Ni-NTA for His-tagged proteins) for initial capture

    • Implement size exclusion chromatography to remove aggregates and free micelles

    • Consider ion exchange chromatography under optimized detergent conditions

    • Validate protein quality after each purification step

Table 6. Optimized purification workflow for recombinant nuoA

Purification StageMethodCritical ParametersQuality Control
ExpressionE. coli C43(DE3), pET system18°C, 0.1 mM IPTG, 16hSDS-PAGE, Western blot
Membrane isolationDifferential centrifugation40,000×g, 4°CMembrane marker enzymes
Solubilizationn-Dodecyl-β-D-maltoside (DDM)1% DDM, 1h, 4°CSolubilized protein quantification
Initial purificationNi-NTA affinity20 mM imidazole washSDS-PAGE, activity assay
Secondary purificationSize exclusion chromatography0.05% DDM in bufferSEC profile, light scattering
Optional stepTag removalSpecific proteaseSDS-PAGE, mass spectrometry
Quality assessmentCircular dichroismFar-UV spectrumSecondary structure content
StorageFlash freezing in aliquots10% glycerol, -80°CThawed sample activity test

This approach has been successful for purifying related membrane proteins from bacterial systems, including components of the electron transport chain . Throughout this process, maintaining a consistent detergent concentration above CMC is crucial to prevent protein aggregation, while buffer components (pH, salt, glycerol) should be optimized to enhance stability.

What techniques can effectively measure recombinant nuoA activity and electron transfer?

Measuring the enzymatic activity of recombinant nuoA is challenging because it functions as part of the larger NADH-quinone oxidoreductase complex. Here's a methodological approach to effectively assess its activity:

  • Whole complex reconstitution:

    • Co-express multiple subunits using polycistronic vectors

    • Purify partial or complete complexes using tagged subunits

    • Reconstitute into proteoliposomes to create a functional system

    • Optimize lipid composition to support native activity

  • Activity measurement methods:

    • NADH oxidation: Monitor absorbance decrease at 340 nm

    • Quinone reduction: Follow absorbance changes at appropriate wavelengths

    • Electron transfer: Use artificial electron acceptors like ferricyanide

    • Proton translocation: Employ pH-sensitive dyes or electrodes

  • Specific nuoA contribution assessment:

    • Complementation assays with complexes lacking nuoA

    • Site-directed mutagenesis of conserved residues

    • Chimeric constructs swapping domains between species

    • Crosslinking studies to identify interaction partners

  • Kinetic parameter determination:

    • Establish steady-state kinetics (Km and Vmax) for NADH and quinones

    • Perform inhibitor studies using specific Complex I inhibitors

    • Determine pH and temperature dependence of activity

    • Assess the effects of salt and detergent on enzyme function

  • Advanced biophysical techniques:

    • Rapid kinetics (stopped-flow spectroscopy)

    • Fluorescence-based assays for conformational changes

    • Electron paramagnetic resonance (EPR) for redox centers

    • Electrochemical methods for direct electron transfer measurement

Table 7. Standard NADH-quinone oxidoreductase activity assay components

ComponentSpecificationConcentrationPurpose
Buffer50 mM phosphate pH 7.4-Maintain pH and ionic strength
NaClAnalytical grade100 mMProvide physiological ionic strength
NADHFreshly prepared100 μMElectron donor
Ubiquinone-1Analytical grade50 μMElectron acceptor
Protein preparationPurified complex or membrane fraction10-50 μg/mLEnzyme source
Rotenone (optional)>95% purity5 μMComplex I-specific inhibitor
Detection methodSpectrophotometric340 nmMonitor NADH oxidation

A similar methodological approach has been used successfully to study related enzyme systems in R. pickettii, such as the HadA monooxygenase system, which also involves electron transfer components .

What approaches can map nuoA interactions with other respiratory chain components?

Understanding how nuoA interacts with other components of the respiratory chain requires multiple complementary approaches to capture both stable and transient interactions:

  • Genetic interaction mapping:

    • Construct deletion mutants of individual subunits

    • Perform genetic complementation studies

    • Create site-directed mutations at predicted interface regions

    • Use bacterial two-hybrid systems adapted for membrane proteins

  • Biochemical interaction identification:

    • Co-purification of interacting partners

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

    • Pull-down assays using tagged nuoA as bait

    • Limited proteolysis to identify protected interaction surfaces

  • Biophysical interaction measurement:

    • Surface plasmon resonance for real-time binding kinetics

    • Microscale thermophoresis for solution-based interaction analysis

    • Isothermal titration calorimetry for thermodynamic profiling

    • Förster resonance energy transfer using fluorescently labeled components

  • Structural approaches:

    • Cryo-electron microscopy of the entire complex

    • X-ray crystallography of subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry

    • Molecular modeling and docking validated by experimental data

  • In vivo interaction validation:

    • In vivo crosslinking under physiological conditions

    • Fluorescence microscopy to track co-localization

    • Activity correlation in different genetic backgrounds

    • Suppressor mutation analysis

Table 8. Complementary approaches for mapping nuoA protein interactions

A similar approach examining protein interactions has been applied to the had operon from R. pickettii DTP0602, revealing crucial interactions between enzymes that enable the complete bioconversion cascade . For example, researchers identified that HadA monooxygenase requires a quinone reductase partner for proper function, similar to how nuoA functions as part of the larger NADH-quinone oxidoreductase complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.