Recombinant Ralstonia pickettii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Protein Overview

nuoK (UniProt IDs: B2U7Q1, C6BJN9) is a 103-amino-acid (aa) subunit of the NADH-quinone oxidoreductase (Complex I), which catalyzes electron transfer from NADH to quinones while pumping protons across the membrane . Key features:

  • Gene Name: nuoK (Rpic12D_1881 or Rpic_2204 in Ralstonia pickettii)

  • Function: Facilitates redox reactions and proton translocation in the respiratory chain .

  • Amino Acid Sequence: MSSLSLAHYLVLGAVLFAISIVGIFLNRKNVIVLLMAIELMLLAVNLNFVAFSHYLGDLA GQVFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDLDSLKG .

Role in Complex I

nuoK is part of the peripheral arm of Complex I, which binds NADH and facilitates electron transfer to FMN and iron-sulfur clusters . Mutations in nuoK may disrupt proton pumping efficiency .

Genomic Context

Genomic studies of Ralstonia pickettii reveal:

  • Core Genome: Enriched in COG categories (J, E, F, H, I) linked to translation, metabolism, and membrane biogenesis .

  • Antimicrobial Resistance: Chromosomal genes like OXA-60 and OXA-22 are conserved, suggesting intrinsic resistance mechanisms .

Biochemical Studies

  • Proton Translocation: nuoK’s role in maintaining the proton gradient is critical for ATP synthesis .

  • Mutagenesis: Site-specific mutations in nuoK are used to study electron transfer kinetics .

Diagnostic Tools

  • ELISA Kits: Recombinant nuoK is used as an immunogen in immunoassays for detecting anti-Ralstonia antibodies .

  • Recombinant Protein Standards: Serves as a control in enzymatic assays .

Challenges and Future Directions

  • Structural Instability: Partial recombinant proteins (e.g., CSB-MP509606RJH1) may lack full functionality compared to full-length versions .

  • Pathogenicity Links: Ralstonia pickettii strains in drinking water show mutations in genes linked to carbon fixation and DNA repair, suggesting adaptive roles for nuoK in environmental survival .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your own protocols.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
nuoK; Rpic_2204; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Ralstonia pickettii (strain 12J)
Target Names
nuoK
Target Protein Sequence
MSSLSLAHYLVLGAVLFAISIVGIFLNRKNVIVLLMAIELMLLAVNLNFVAFSHYLGDLA GQVFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDLDSLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ralstonia pickettii and why is it significant in research?

Ralstonia pickettii is a Gram-negative bacillus that has increasingly been recognized as an emerging nosocomial pathogen, particularly in immunocompromised hosts. It is an aerobic non-fermenting bacillus naturally found in soil and water environments . The significance of R. pickettii in research stems from its clinical importance as the most prominent pathogen from the Ralstonia genus, capable of causing invasive infections including bacteremia, pneumonia, endocarditis, meningitis, and septic arthritis . Despite being considered an organism of low virulence, it has demonstrated a propensity to cause severe infections in immunocompromised individuals, resulting in significant mortality and morbidity, making it an important subject for microbiological and biochemical studies .

What is NADH-quinone oxidoreductase subunit K (nuoK) and what role does it play in Ralstonia pickettii?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the bacterial respiratory chain complex I, which is critical for energy metabolism in prokaryotic organisms. In Ralstonia pickettii, this protein participates in the electron transport chain, functioning as part of the membrane-embedded hydrophobic domain of the NADH dehydrogenase complex. This complex catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the membrane, contributing to the establishment of a proton gradient that drives ATP synthesis. The nuoK subunit specifically plays a role in proton translocation through the bacterial membrane, making it essential for the energy metabolism of R. pickettii .

What experimental approaches are commonly used to study recombinant proteins like R. pickettii nuoK?

Recombinant proteins like R. pickettii nuoK can be studied using several experimental approaches:

  • Protein Expression Systems: Heterologous expression in bacterial systems (E. coli), yeast, or mammalian cells to produce sufficient quantities for analysis.

  • Protein Purification: Affinity chromatography, ion exchange chromatography, and size exclusion chromatography to isolate the protein of interest.

  • Functional Assays: Enzymatic activity measurements to assess the protein's catalytic properties.

  • Structural Analysis: X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to determine protein structure.

  • Electroporation: As demonstrated with other recombinant proteins, electroporation can deliver recombinant proteins into cells for functional studies. This technique allows for uniform delivery of proteins across a cell population, which is advantageous for biochemical analyses compared to techniques like microinjection .

How does the experimental design affect research outcomes when studying recombinant proteins?

The choice of experimental design significantly impacts research outcomes when studying recombinant proteins like R. pickettii nuoK. Experimental designs can be broadly classified as experimental and nonexperimental .

In experimental designs:

  • Researchers can establish causality by controlling variables and making comparisons between experimental and control groups

  • Random assignment ensures that groups are equivalent except for the treatment variable

  • This approach is optimal for explanatory research aimed at establishing causality

For recombinant protein studies, experimental designs might include:

  • Testing different expression conditions to optimize protein yield

  • Comparing activity of wild-type versus mutant proteins

  • Evaluating protein function in complementation assays

The selection of design depends on research objectives. While experimental designs are preferred for establishing causality, nonexperimental designs may be appropriate when:

  • Ethical concerns prevent random assignment

  • The research goal is information gathering rather than establishing causality

  • Practical limitations exist that prevent implementation of a true experiment

What methodological challenges exist in expressing and purifying functional Ralstonia pickettii nuoK protein for research applications?

Several methodological challenges exist when expressing and purifying functional R. pickettii nuoK protein:

  • Membrane Protein Solubility: As a membrane-embedded subunit, nuoK is highly hydrophobic, making it difficult to express in soluble form. Researchers must optimize detergent conditions or employ membrane-mimetic systems like nanodiscs or liposomes to maintain protein stability and function.

  • Maintaining Native Conformation: The function of nuoK depends on its proper folding and integration into the respiratory complex. Expressing it in isolation may result in misfolding or aggregation.

  • Co-expression Requirements: The nuoK subunit normally functions as part of a multi-subunit complex. To obtain functional protein, co-expression with partner subunits may be necessary, significantly complicating expression and purification protocols.

  • Post-translational Modifications: As observed with other recombinant proteins, achieving complete functional activity may require higher intracellular levels of recombinant protein than those of endogenous counterparts due to potential limitations in post-translational modifications or partial proteolysis .

  • Expression Host Compatibility: Choosing an appropriate expression host is critical, as different hosts may process the protein differently, affecting its function and stability.

Table 1: Common Strategies for Overcoming Membrane Protein Expression Challenges

StrategyApproachAdvantagesLimitations
Fusion tagsAdd solubility-enhancing tags (MBP, SUMO)Improves solubility and expressionMay interfere with protein function
Detergent screeningTest various detergents for protein extractionIdentifies optimal solubilization conditionsDetergents may affect protein activity
Expression host optimizationTry different bacterial strains or eukaryotic hostsMay improve folding and yieldRequires extensive screening
Co-expressionExpress with partner proteinsEnhances stability and foldingIncreases complexity of purification
Nanodiscs/liposomesReconstitute in membrane-mimetic systemsMaintains native-like environmentTechnical complexity in preparation

How can recombinant Ralstonia pickettii nuoK be utilized for functional complementation studies in research?

Recombinant R. pickettii nuoK can be utilized for functional complementation studies through several approaches:

  • Electroporation-Based Delivery: As demonstrated with other recombinant proteins, electroporation can efficiently deliver recombinant nuoK into cells at controlled concentrations. This approach provides advantages over other protein targeting techniques such as microinjection, as it allows uniform protein delivery to a large number of cells, making it suitable for biochemical analyses .

  • RNAi-Complementation Assays: Similar to studies with other recombinant proteins, researchers can deplete endogenous nuoK using RNA interference (RNAi) and then assess whether electroporated recombinant nuoK rescues the phenotype. This approach can help determine if the recombinant protein is functionally active .

  • Mutant Complementation: Introducing recombinant wild-type nuoK into mutant strains deficient in this protein can help assess its function. By monitoring the restoration of respiratory chain activity, researchers can evaluate the functional capacity of the recombinant protein.

  • Structure-Function Analysis: Systematic mutation of key residues in recombinant nuoK followed by functional complementation can identify critical amino acids for protein function and interaction with other subunits of the respiratory complex.

The success of complementation studies depends on achieving appropriate intracellular levels of the recombinant protein. As observed with other recombinant proteins, complete functional rescue may require higher levels of the recombinant protein compared to endogenous counterparts, possibly due to limitations in post-translational modifications or partial proteolysis .

What analytical techniques can be employed to assess the protein-protein interactions of nuoK within the NADH-quinone oxidoreductase complex?

Several analytical techniques can be employed to study protein-protein interactions of nuoK within the NADH-quinone oxidoreductase complex:

  • Crosslinking Mass Spectrometry (XL-MS): This technique uses chemical crosslinkers to capture interacting proteins, followed by mass spectrometry to identify interaction sites between nuoK and other subunits.

  • Co-immunoprecipitation (Co-IP): By using antibodies against nuoK or other complex subunits, researchers can pull down interacting partners and analyze them by western blotting or mass spectrometry.

  • Förster Resonance Energy Transfer (FRET): Fluorescently labeled nuoK and potential interaction partners can be analyzed for proximity-based energy transfer, indicating direct interactions.

  • Blue Native PAGE: This non-denaturing electrophoresis technique preserves protein complexes and can reveal the integration of nuoK into larger assemblies.

  • Surface Plasmon Resonance (SPR): This technique can measure binding kinetics between purified nuoK and other subunits of the complex.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This method identifies protein interaction interfaces by measuring changes in hydrogen-deuterium exchange rates upon complex formation.

These techniques can reveal structural relationships similar to those observed in other multi-protein complexes, such as the kinetochore protein complexes studied using similar methodologies .

How does the pathogenicity of Ralstonia pickettii influence experimental approaches when working with its recombinant proteins?

The pathogenicity of Ralstonia pickettii necessitates specific considerations when working with its recombinant proteins:

  • Biosafety Measures: As R. pickettii is an emerging nosocomial pathogen capable of causing severe infections, particularly in immunocompromised hosts, appropriate biosafety measures must be implemented when working with live organisms or their components .

  • Heterologous Expression Systems: To minimize exposure risks, researchers often express R. pickettii proteins in non-pathogenic hosts like laboratory strains of E. coli, which requires optimization of codon usage and expression conditions.

  • Inactivation Protocols: When working with native protein extracts from R. pickettii, reliable inactivation protocols must be established to ensure complete neutralization of potential infectious components.

  • Clinical Strain Selection: Careful consideration should be given to strain selection, as R. pickettii isolates from clinical settings, particularly those involved in bloodstream infections, may have different virulence factors that could influence protein function and experimental outcomes .

  • Contamination Prevention: Given that R. pickettii outbreaks have been associated with contaminated medical solutions including saline and sterile water, stringent measures to prevent environmental contamination are essential .

Table 2: Risk Factors and Mitigation Strategies for Working with R. pickettii Proteins

Risk FactorClinical RelevanceExperimental ImplicationMitigation Strategy
Immunocompromised host infectionsHigh pathogenicity in vulnerable populations Potential for laboratory-acquired infectionsEnhanced biosafety protocols; restricted access
Hospital-acquired infectionsAssociated with prolonged hospital stays Environmental persistenceDedicated equipment; regular decontamination
Contamination of medical solutionsSource of outbreaks Cross-contamination riskSterile technique; separate preparation areas
Antibiotic resistanceVariable sensitivities to carbapenems and aminoglycosides Treatment challenges if exposure occursAntibiotic susceptibility testing; preventive measures
Central line-associated infectionsDocumented CLABSI cases Risk during invasive proceduresEnhanced personal protective equipment when handling cultures

What strategies can be employed to overcome challenges in recombinant expression of membrane proteins like nuoK?

Several strategies can be employed to overcome challenges in recombinant expression of membrane proteins like nuoK:

  • Fusion Partner Optimization:

    • Testing various fusion partners (MBP, SUMO, Trx) to enhance solubility

    • Employing cleavable tags to remove fusion partners post-purification

  • Host Cell Engineering:

    • Using C41(DE3) or C43(DE3) E. coli strains, which are specialized for membrane protein expression

    • Employing Lemo21(DE3) strains that allow titration of expression levels

  • Induction Optimization:

    • Lowering temperature during induction (15-20°C)

    • Using lower inducer concentrations

    • Extending expression time with gentler induction conditions

  • Solubilization and Stabilization:

    • Systematic screening of detergents for extraction efficiency and protein stability

    • Incorporation of lipids during solubilization to maintain native-like environment

    • Application of amphipols or nanodiscs for stabilization

  • Co-expression Strategies:

    • Co-expressing multiple subunits of the complex simultaneously

    • Including chaperone proteins to assist proper folding

Table 3: Optimization Parameters for Membrane Protein Expression

ParameterConventional ConditionsOptimized Conditions for Membrane ProteinsExpected Impact
Temperature37°C15-20°CSlows folding, reduces aggregation
Inducer concentration0.5-1 mM IPTG0.1-0.2 mM IPTGReduces expression rate, improves folding
MediaLBTB or Super BrothProvides nutrients for extended expression
AdditivesNoneGlycerol (5-10%)Stabilizes membranes
Host strainBL21(DE3)C41(DE3), C43(DE3)Tolerates membrane protein toxicity
Expression time4-6 hours16-24 hoursAllows gradual accumulation

These strategies would need to be empirically tested and optimized specifically for R. pickettii nuoK, as membrane protein behavior can vary significantly between different proteins and organisms.

How can researchers distinguish between effects caused by nuoK mutations versus those resulting from experimental artifacts?

Distinguishing between genuine effects of nuoK mutations and experimental artifacts requires several methodological approaches:

  • Multiple Mutation Strategies:

    • Create the same functional mutation using different codon changes

    • Develop multiple mutational approaches to disrupt the same function

    • If different mutations affecting the same functional domain produce similar phenotypes, this strengthens evidence for a genuine effect

  • Complementation Testing:

    • After observing effects of nuoK mutations, introduce wild-type nuoK through methods such as electroporation

    • If the phenotype is rescued, this confirms the mutation was responsible for the observed effect

    • Similar to complementation assays demonstrated with other recombinant proteins

  • Dosage Response Analysis:

    • Test different concentrations of recombinant proteins

    • Establish a relationship between protein level and phenotypic effect

    • As observed with other recombinant proteins, complete functional rescue may require higher intracellular levels than endogenous proteins

  • Control Mutations:

    • Include neutral mutations that shouldn't affect function

    • Design conservative mutations that maintain similar biochemical properties

    • These serve as controls to distinguish specific from non-specific effects

  • Multiple Assay Systems:

    • Measure effects using different experimental approaches

    • If the same result is observed across different methodologies, it's less likely to be an artifact

  • Statistical Rigor:

    • Perform sufficient biological and technical replicates

    • Use appropriate statistical tests to establish significance

    • Calculate effect sizes to determine biological relevance beyond statistical significance

What statistical approaches are most appropriate for analyzing functional data from nuoK mutant studies?

When analyzing functional data from nuoK mutant studies, several statistical approaches are appropriate depending on the experimental design and data characteristics:

  • For Comparing Multiple Mutants to Wild-Type:

    • Analysis of Variance (ANOVA) followed by post-hoc tests (Tukey's HSD, Dunnett's test) when comparing multiple mutants to a wild-type control

    • Dunnett's test is particularly useful as it specifically compares each experimental group to a single control group

    • For non-normally distributed data, Kruskal-Wallis test followed by Dunn's test

  • For Dose-Response Relationships:

    • Regression analysis to establish relationships between protein concentration and activity

    • Non-linear regression for enzyme kinetics data (Michaelis-Menten, Hill equation)

    • As observed with MIS12C proteins, recombinant proteins may require higher concentrations than endogenous counterparts to achieve full function

  • For Time-Course Experiments:

    • Repeated measures ANOVA when the same samples are measured over time

    • Mixed-effects models to account for both fixed effects (mutation type) and random effects (individual sample variation)

  • For Binary Outcomes:

    • Logistic regression for outcomes such as "functional" vs. "non-functional"

    • Chi-square tests for categorical comparisons

  • Advanced Multivariate Approaches:

    • Principal Component Analysis (PCA) to identify patterns in complex datasets

    • Hierarchical clustering to group mutations with similar functional profiles

Regardless of the statistical method chosen, researchers should:

  • Clearly define null and alternative hypotheses

  • Determine appropriate sample sizes through power analysis

  • Test assumptions of the statistical tests being used

  • Report effect sizes alongside p-values to indicate biological significance

How can researchers integrate structural information with functional data to understand nuoK's role in the NADH-quinone oxidoreductase complex?

Integrating structural information with functional data provides powerful insights into nuoK's role in the NADH-quinone oxidoreductase complex:

  • Structure-Guided Mutagenesis:

    • Use structural models to identify critical residues for mutation

    • Target conserved residues, putative interaction interfaces, and functionally important domains

    • Create rational mutation libraries based on structural predictions

    • Test mutants using functional assays to validate structural hypotheses

  • Molecular Dynamics Simulations:

    • Simulate the behavior of wild-type and mutant nuoK within membrane environments

    • Identify conformational changes that might explain functional alterations

    • Predict how mutations affect protein stability and interactions

  • Evolutionary Conservation Analysis:

    • Map sequence conservation onto structural models

    • Identify highly conserved regions likely critical for function

    • Compare conservation patterns across related bacterial species

  • Interaction Mapping:

    • Use crosslinking techniques coupled with mass spectrometry to identify interaction partners

    • Map interaction data onto structural models to create comprehensive interaction networks

    • Similar to approaches used for analyzing protein complexes in other systems

  • Integrative Modeling:

    • Combine data from multiple experimental approaches (cryo-EM, X-ray crystallography, crosslinking)

    • Generate comprehensive models of the entire complex

    • Validate models through functional tests of predictions

Table 4: Integration of Structural and Functional Approaches for nuoK Analysis

Structural InformationFunctional AssayIntegration ApproachExpected Insight
Transmembrane topologyMembrane integration assaysCorrelation of predicted vs. observed topologyValidation of structural model
Conserved residuesSite-directed mutagenesisMapping activity changes to structureIdentification of functional hotspots
Interaction interfacesCo-immunoprecipitationConfirmation of predicted interactionsValidation of complex assembly model
Conformational changesActivity assays under varying conditionsCorrelation of structural states with functionUnderstanding of mechanistic details
Electrostatic surfaceIon translocation measurementsMapping of charged pathwaysInsights into proton translocation mechanism

What are the emerging research directions for studying Ralstonia pickettii nuoK in the context of bacterial pathogenesis?

Several emerging research directions show promise for understanding R. pickettii nuoK in the context of bacterial pathogenesis:

  • Metabolic Adaptation During Infection:

    • Investigating how nuoK function changes during different stages of infection

    • Examining whether alterations in respiratory chain function contribute to persistence in hospital environments

    • Understanding how energy metabolism adapts to the host environment during infection

  • Drug Target Potential:

    • Assessing whether nuoK could serve as a novel antibiotic target

    • Developing inhibitors specific to R. pickettii respiratory complexes

    • Evaluating whether targeting energy metabolism could reduce virulence or persistence

  • Host-Pathogen Interactions:

    • Investigating how host immune responses affect bacterial energy metabolism

    • Examining whether nuoK participates in stress responses during infection

    • Understanding how metabolic adaptation contributes to immune evasion

  • Biofilm Formation and Persistence:

    • Exploring the role of energy metabolism in biofilm formation

    • Determining if nuoK function differs in planktonic versus biofilm states

    • Investigating how biofilm-associated metabolic changes contribute to antimicrobial resistance

  • Comparative Analysis Across Clinical Isolates:

    • Examining sequence and functional variations in nuoK across clinical isolates

    • Correlating these variations with virulence or persistence

    • Understanding how nuoK evolution may contribute to the emergence of R. pickettii as a hospital-acquired pathogen

These research directions would benefit from the application of experimental design principles discussed earlier, particularly in establishing causality between nuoK function and pathogenic traits .

How might advances in protein delivery methods enhance future studies of recombinant R. pickettii proteins?

Advances in protein delivery methods offer significant potential for enhancing future studies of recombinant R. pickettii proteins:

  • Refined Electroporation Techniques:

    • Building on established electroporation protocols shown to deliver uniform amounts of recombinant proteins into cells

    • Optimizing parameters specifically for delivery of membrane proteins like nuoK

    • Developing cell-type specific protocols for different experimental systems

  • Nanoparticle-Based Delivery Systems:

    • Encapsulating recombinant proteins in lipid nanoparticles for enhanced cellular uptake

    • Engineering targeted delivery to specific cell types

    • Creating sustained-release formulations for prolonged experimental windows

  • Cell-Penetrating Peptides (CPPs):

    • Fusing recombinant proteins with CPPs to facilitate cellular entry

    • Designing cleavable CPP tags that separate after delivery

    • Optimizing CPP sequences for specific cell types

  • Optogenetic and Chemogenetic Control:

    • Incorporating light or chemical-sensitive domains to control protein activity after delivery

    • Enabling temporal control of protein function in experimental systems

    • Allowing for more precise dissection of protein function in complex systems

  • In vivo Delivery Systems:

    • Developing methods for organism-level delivery of recombinant proteins

    • Creating tissue-specific targeting approaches

    • Enabling in vivo functional complementation studies

These advances would build upon current techniques that have demonstrated the ability to deliver functional recombinant proteins and achieve complete functional rescue in various experimental systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.