Recombinant Ralstonia pickettii Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Enzymatic Activity

  • Classification: Metalloprotease (zinc-dependent) .

  • Function: Likely involved in membrane protein quality control, analogous to E. coli HtpX, which cleaves misfolded membrane proteins like SecY .

Functional Studies

  • Used to investigate proteolytic mechanisms in R. pickettii, particularly under stress conditions .

  • Potential role in bacterial adaptability, as genomic analyses reveal htpX within flexible genomic regions prone to horizontal gene transfer (HGT) in R. pickettii .

Pathogenicity Insights

  • R. pickettii virulence factors include proteases like RpA, but HtpX’s direct role in pathogenicity remains underexplored .

Comparative Analysis with Homologs

HtpX Across Species

FeatureR. pickettii HtpXE. coli HtpX
LocalizationMembrane-boundMembrane-bound
SubstrateUndefined (putative membrane proteins)SecY, casein
Metal DependencyZincZinc
InductionStress-responsive (inferred)Stress-controlled

Limitations and Future Directions

  • No kinetic data (e.g., kcatk_{\text{cat}}, KmK_m) are available for the recombinant enzyme.

  • Functional studies in R. pickettii are needed to confirm its role in stress adaptation or virulence.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Rpic_3675; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Ralstonia pickettii (strain 12J)
Target Names
htpX
Target Protein Sequence
MFNWIKTFMLMAAITALFIVIGGMIGGRSGMMLALLFALGMNFFSYWFSDKMVLRMYNAQ EVNETSAPQFYRMVQELAGRAGLPMPRVYLIDEAQPNAFATGRNPEHAAVAATTGILNIL SERELRGVMAHELAHVQHRDILISTISATMAGAISALANFAVFFGGRDSEGRPANPIAGI AVAILAPLAAAMIQMAISRAREFEADRGGATISGDPQALASALDKIHRYAAGIPFAAAEA HPATAQMMIMNPLHGGGLANLFSTHPATEERIARLMQMAQTGQYPA
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ralstonia pickettii Protease HtpX homolog and what is its significance in research?

Ralstonia pickettii Protease HtpX homolog (htpX) is a membrane-bound zinc metalloproteinase belonging to the M48 family, similar to HtpX in Escherichia coli. It is encoded by the htpX gene (locus name Rpic_3675) in Ralstonia pickettii strain 12J. The protein plays a crucial role in membrane protein quality control, functioning to eliminate malfolded or misassembled membrane proteins that could potentially disrupt cellular membrane integrity and function . Understanding this protease is significant for research into bacterial membrane protein homeostasis, stress responses, and potentially for developing novel antimicrobial strategies targeting Ralstonia species.

What are the structural characteristics of Recombinant Ralstonia pickettii Protease HtpX homolog?

The Recombinant Ralstonia pickettii Protease HtpX homolog is a full-length protein containing 286 amino acids. Its amino acid sequence is:

MFNWIKTFMLMAAITAIFIVIGGMIGGRSGMLALLFALGNFFSYWFSDKMVLRMYNAQEVNETSAPQFYRMVQELAGRAGLPMPRVYLIDEAQPNAFATGRNPEHAAVAATTGILNILSERELRGVMAHELAHVQHRDILISTISATMAGAISALANFAVFFGGRDSEGRPANPIAGIAVAILAPLAAAMIQMAISRAREFEADRGGATISGDPQALASALDKIHRYAAGIPFAAAEAHPATAQMMIMNPLHGGGLANLFSTHPATEERIARLMQMAQTGQYPA

Like other members of the HtpX family, it likely contains multiple hydrophobic regions that may function as transmembrane segments, though the exact membrane topology may need further characterization based on comparison with E. coli HtpX, which has four hydrophobic regions (H1-H4) .

What are the optimal storage conditions for Recombinant Ralstonia pickettii Protease HtpX homolog?

For optimal preservation of Recombinant Ralstonia pickettii Protease HtpX homolog:

  • Store the protein at -20°C for regular use

  • For extended storage, maintain at -20°C or -80°C

  • The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability

  • Avoid repeated freezing and thawing cycles as this may compromise protein integrity

  • For working solutions, store aliquots at 4°C for up to one week

These storage recommendations help maintain the structural integrity and enzymatic activity of the recombinant protein for research applications.

How can researchers design an effective in vivo assay system to study HtpX protease activity?

Based on methodologies developed for E. coli HtpX, researchers can establish an in vivo protease activity assay system for Ralstonia pickettii HtpX by:

  • Constructing a model substrate: Design a fusion protein containing a cleavage site recognized by HtpX, similar to the XMS1 (HtpX Model Substrate 1) developed for E. coli studies

  • Incorporating detection tags: Include N-terminal and C-terminal tags (such as GFP or epitope tags) that allow monitoring of substrate cleavage through immunoblotting or fluorescence measurements

  • Co-expression system: Establish a system where both the HtpX protease and its model substrate are co-expressed in the same cells

  • Detection method: Implement a semiquantitative detection method, such as western blotting with antibodies against the tags, to monitor the appearance of cleaved fragments (CL-N and CL-C) and disappearance of full-length substrate (XMS1-FL)

  • Controls: Include controls with catalytically inactive HtpX mutants (e.g., mutations in the conserved HEXXH motif) and HtpX deletion strains

This approach enables researchers to detect differential protease activities of wild-type HtpX versus mutant variants, facilitating structure-function analyses .

What methods are recommended for identifying physiological substrates of Ralstonia pickettii HtpX?

To identify physiological substrates of Ralstonia pickettii HtpX, researchers should consider these methodological approaches:

  • Comparative proteomics: Compare membrane protein profiles between wild-type R. pickettii and htpX deletion mutants using techniques such as:

    • 2D gel electrophoresis followed by mass spectrometry

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with LC-MS/MS

    • TMT (Tandem Mass Tag) labeling for quantitative proteomics

  • Co-immunoprecipitation studies: Express tagged versions of HtpX (similar to the HtpX-His6-Myc or HtpX-His10 constructs used in E. coli studies) to pull down interacting proteins or substrates

  • Degradomics approaches: Use N-terminomics or C-terminomics to identify specific cleavage sites in substrate proteins

  • In vitro reconstitution: Purify recombinant HtpX and test its activity against candidate substrate proteins in reconstituted membrane systems

  • Genetic screening: Screen for genetic interactions between htpX and other genes involved in membrane protein quality control to identify functional relationships and potential substrates

These approaches can be complementary and may collectively provide a comprehensive understanding of the physiological role of HtpX in R. pickettii.

How do mutations in conserved regions affect the proteolytic activity of HtpX?

Mutations in conserved regions of HtpX are likely to significantly impact its proteolytic activity. Based on E. coli HtpX studies, researchers should consider:

  • HEXXH motif mutations: This zinc-binding motif is crucial for metalloprotease activity. Mutations in the histidine or glutamate residues would be expected to abolish catalytic activity by disrupting zinc coordination

  • Conserved transmembrane segments: Mutations affecting membrane topology could disrupt substrate recognition or access to the catalytic site

  • Quantitative assessment: The established in vivo protease activity assay system with model substrates allows semiquantitative measurement of how different mutations affect proteolytic function

  • Correlation studies: Correlate the effects of mutations on protease activity with structural features to gain insights into the mechanism of substrate recognition and cleavage

Systematic mutagenesis of conserved regions, coupled with activity assays, can provide valuable insights into structure-function relationships of HtpX proteases.

What is the relationship between HtpX and bacterial antibiotic resistance in Ralstonia pickettii?

Ralstonia pickettii is known to exhibit resistance to multiple antibiotics, often carrying genes for class D oxacillinases such as blaOXA-22 and blaOXA-60 . While direct evidence linking HtpX to antibiotic resistance mechanisms in R. pickettii is not explicitly stated in the provided search results, several potential relationships could be explored:

  • Membrane protein quality control: As a membrane protease involved in protein quality control, HtpX might indirectly affect drug influx/efflux by influencing membrane protein composition and integrity

  • Stress response integration: HtpX might function as part of a broader stress response network that is activated during antibiotic exposure

  • Biofilm formation: R. pickettii isolates have been shown to produce biofilm , and membrane proteases like HtpX could potentially affect biofilm formation by influencing membrane protein turnover

  • Research approach: To investigate these potential connections, researchers could:

    • Compare antibiotic susceptibility profiles between wild-type and htpX deletion mutants

    • Examine whether antibiotic exposure affects htpX expression levels

    • Investigate whether HtpX influences the stability or activity of known resistance determinants

This represents an important area for future research, especially given the clinical significance of Ralstonia species as emerging opportunistic pathogens with antibiotic resistance.

How does the expression of htpX change under different stress conditions in Ralstonia pickettii?

Although specific data on htpX expression in Ralstonia pickettii under various stress conditions is not provided in the search results, researchers can design experiments to investigate this question based on knowledge from related bacteria:

  • Stress conditions to examine:

    • Heat shock (as suggested by the "Htp" designation, indicating heat shock protein)

    • Membrane stress induced by detergents or membrane-targeting antibiotics

    • Oxidative stress

    • Nutrient limitation

    • pH stress

    • Biofilm formation conditions

  • Expression analysis methods:

    • qRT-PCR to measure htpX mRNA levels

    • Western blotting using antibodies against HtpX

    • Reporter gene fusions (e.g., htpX promoter fused to GFP or luciferase)

    • RNA-seq for genome-wide expression profiling

  • Correlation with physiological responses:

    • Monitor changes in membrane integrity

    • Assess bacterial survival and growth rates

    • Analyze changes in membrane protein profiles

Understanding the regulation of htpX expression under different stress conditions would provide insights into its physiological role in bacterial stress responses and adaptation.

What is the clinical significance of Ralstonia pickettii infections and how might HtpX contribute to its pathogenicity?

Ralstonia pickettii is an emerging opportunistic pathogen increasingly recognized in healthcare settings:

  • Clinical manifestations:

    • Capable of causing persistent and relapsing bacteremia

    • Reported to cause infections of the seminal tract, bones, joints (including prosthetic joints)

    • Can lead to infective endocarditis, severe pneumonia, and fulminant sepsis

    • Often associated with infections in immunosuppressed patients

  • Potential contributions of HtpX to pathogenicity:

    • Membrane homeostasis during host stress responses

    • Adaptation to changing environments during infection

    • Potential role in biofilm formation, which R. pickettii isolates have been shown to produce

    • Possible involvement in stress tolerance within host environments

  • Research implications:

    • HtpX could represent a potential therapeutic target for novel antimicrobial strategies

    • Understanding HtpX function might help explain the persistence of R. pickettii in clinical settings

While direct evidence linking HtpX to R. pickettii virulence is not provided in the search results, its fundamental role in membrane protein quality control suggests it could be important for bacterial survival during infection.

What differences exist in antibiotic susceptibility patterns between Ralstonia pickettii and other Ralstonia species?

Based on the clinical case studies in the search results, there are notable differences in antibiotic susceptibility patterns between Ralstonia species:

AntibioticR. pickettiiR. mannitolilytica
Beta-lactamsResistant to mostResistant
Piperacillin/tazobactamResistantSusceptible
ImipenemSusceptibleResistant
AminoglycosidesSusceptibleResistant

These different resistance profiles highlight the importance of correct species-level identification for proper clinical management of Ralstonia infections . The different resistance patterns may be explained by species-specific beta-lactamases and other resistance mechanisms:

  • R. pickettii: Often carries blaOXA-22 and blaOXA-60 (an inducible oxacillinase with carbapenem-hydrolyzing property)

  • R. mannitolilytica: Typically harbors the intrinsically species-specific class D oxacillinases blaOXA-443 and blaOXA-444, as well as a serine-hydrolase class C family beta-lactamase

The resistance mechanisms may also involve other factors such as porin deficiency or overexpression of efflux pumps . This data underscores the clinical importance of accurate species identification and antibiotic susceptibility testing when dealing with Ralstonia infections.

What experimental approaches can be used to determine the membrane topology of Ralstonia pickettii HtpX?

To determine the membrane topology of Ralstonia pickettii HtpX, researchers can employ several complementary experimental approaches:

  • Hydropathy analysis and topology prediction:

    • Use bioinformatics tools to predict transmembrane segments based on the amino acid sequence

    • Compare with the topology of E. coli HtpX, which has four hydrophobic regions (H1-H4) that could function as transmembrane segments

  • Fusion protein approach:

    • Create fusion proteins with reporter tags (such as PhoA, LacZ, or GFP) at different positions

    • The activity or fluorescence of these reporters depends on their cellular localization (cytoplasmic vs. periplasmic), enabling mapping of membrane topology

  • Cysteine accessibility methods:

    • Introduce cysteine residues at various positions and test their accessibility to membrane-impermeable sulfhydryl reagents

    • This approach can determine which regions are exposed to which side of the membrane

  • Protease protection assays:

    • Expose membrane vesicles to proteases, with or without membrane permeabilization

    • Analyze the resulting fragments to determine which regions are protected by the membrane

  • Cryo-electron microscopy:

    • For higher-resolution structural analysis, particularly if the protein can be purified in sufficient quantities while maintaining its native conformation

These approaches would help resolve questions about the membrane topology of R. pickettii HtpX, particularly whether the C-terminal hydrophobic regions are indeed embedded in the membrane, which remains controversial even for the well-studied E. coli HtpX .

How can researchers identify the specific cleavage sites of HtpX in its substrates?

To identify specific cleavage sites of HtpX in substrate proteins, researchers should consider these methodological approaches:

  • N-terminal sequencing of cleavage products:

    • Generate cleavage fragments in vitro using purified HtpX and substrate proteins

    • Isolate the C-terminal fragments and perform Edman degradation to identify the new N-terminus, which reveals the cleavage site

  • Mass spectrometry approaches:

    • Use LC-MS/MS to identify and quantify peptides before and after HtpX treatment

    • Terminal amine isotopic labeling of substrates (TAILS) can specifically identify new N-termini generated by proteolytic cleavage

  • Site-directed mutagenesis of potential cleavage sites:

    • Systematically mutate amino acids around predicted cleavage sites in model substrates

    • Test how these mutations affect cleavage efficiency using the in vivo protease activity assay system

  • In silico analysis:

    • Compare known substrates to identify consensus sequence motifs that might be recognized by HtpX

    • Use machine learning approaches trained on experimentally validated cleavage sites to predict new potential cleavage sites

  • Structural studies of enzyme-substrate complexes:

    • X-ray crystallography or cryo-EM studies of HtpX in complex with substrate peptides containing the cleavage site

    • This approach is more challenging but could provide detailed insights into the recognition mechanism

Understanding the cleavage site specificity would provide important insights into substrate recognition by HtpX and could aid in identifying physiological substrates.

What are the most promising future research directions for Ralstonia pickettii HtpX studies?

Future research on Ralstonia pickettii HtpX should focus on several key areas:

  • Physiological role determination:

    • Identification of natural substrates in R. pickettii

    • Creation of clean htpX deletion mutants to examine phenotypic consequences

    • Investigation of potential roles in stress responses and antibiotic resistance

  • Structural biology approaches:

    • Determination of high-resolution structures of R. pickettii HtpX

    • Elucidation of the catalytic mechanism and substrate binding sites

    • Comparison with HtpX homologs from other bacteria to identify conserved and unique features

  • Systems biology integration:

    • Investigation of the regulatory networks controlling htpX expression

    • Exploration of functional interactions with other quality control systems

    • Examination of the role of HtpX in the broader context of bacterial physiology

  • Translational applications:

    • Assessment of HtpX as a potential drug target

    • Development of specific inhibitors of HtpX activity

    • Exploration of connections between HtpX function and bacterial persistence in clinical settings

  • Methodological advances:

    • Development of improved assay systems specific for R. pickettii HtpX

    • Adaptation of the model substrate approach used for E. coli HtpX

    • Implementation of high-throughput screening methods for substrate identification

These research directions would significantly advance our understanding of this important membrane protease and could potentially lead to new strategies for controlling R. pickettii infections.

How can comparative analysis of HtpX homologs from different bacterial species inform our understanding of their evolutionary significance?

Comparative analysis of HtpX homologs across bacterial species can provide valuable insights into:

  • Evolutionary conservation and divergence:

    • Identification of universally conserved domains suggesting core functional requirements

    • Recognition of species-specific variations that might reflect adaptations to different ecological niches

    • Mapping of the evolutionary trajectory of HtpX proteases across bacterial phylogeny

  • Structure-function relationships:

    • Correlation of sequence variations with functional differences

    • Identification of critical residues maintained throughout evolution

    • Elucidation of species-specific substrate preferences

  • Methodological approaches:

    • Phylogenetic analysis of HtpX sequences from diverse bacterial species

    • Comparative biochemical characterization of HtpX homologs

    • Heterologous expression studies to test functional complementation

    • Analysis of genomic context to identify conserved gene neighborhoods

  • Systems-level insights:

    • Comparison of HtpX regulation across species

    • Examination of how HtpX function is integrated into different cellular networks

    • Assessment of the contribution of HtpX to fitness in different bacterial lifestyles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.