Recombinant Ralstonia solanacearum Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Ralstonia solanacearum Apolipoprotein N-acyltransferase (Lnt)

Recombinant Ralstonia solanacearum Apolipoprotein N-acyltransferase (Lnt) is a heterologously produced enzyme critical for post-translational modification of bacterial lipoproteins. Lipoproteins are essential for bacterial membrane integrity, nutrient transport, and virulence, with their maturation involving sequential enzymatic modifications. Lnt catalyzes the final step of N-acylation, adding an acyl group to the N-terminal cysteine residue of mature lipoproteins, a process unique to Gram-negative bacteria like R. solanacearum .

Protein Structure

The recombinant Lnt from R. solanacearum (strain GMI1000) has a predicted molecular weight of ~57 kDa (523 amino acids). Key structural features include:

  • Dynamic arm: A flexible region modulating substrate access to the active site, as observed in E. coli Lnt .

  • Active site cysteine: Forms thioester intermediates during acylation .

  • Conserved domains: Includes a putative acyltransferase domain homologous to E. coli Lnt .

Table 1: Amino Acid Sequence Highlights

SegmentSequence (Partial)Notes
N-terminalMRALFSSPAADTAGQQEALAVPLARLRFAAPLAALLGVMHTLAFAPNRWWWLQILSLAGLSignal peptide?
CoreAALVRQAPRLRDVAWVGYAFGLGWFLSGIWWLYISMHVYGDMPAWMAAAAVLLFSAYLALPutative acyltransferase domain
C-terminal...QGMQGLTPFVRTGNAPALGAGVLVLLAALARRRRAGAARegulatory regions?

Data derived from UniProt entry Q8Y210 .

Enzymatic Activity and Substrate Specificity

Lnt transfers fatty acids from phospholipids to the N-terminal cysteine of mature lipoproteins. In Mycobacterium species, analogous Lnt enzymes use C16 fatty acids for N-acylation, while diacylglycerol residues incorporate C16 and C19:0 (tuberculostearic acid) . For R. solanacearum, fatty acid preferences remain uncharacterized but are inferred to align with Gram-negative bacterial lipid profiles.

Key Functional Insights:

  • Triacylation: Ensures proper membrane anchoring and immune evasion by modifying lipoprotein lipidation .

  • Substrate Range: Likely includes apolipoproteins with conserved N-terminal cysteine motifs .

Recombinant Production

  • Host systems: Typically expressed in E. coli or other compatible systems with optimized tags (e.g., His-tag, GST-tag) .

  • Purification: Affinity chromatography followed by gel filtration .

  • Storage: Tris-based buffer with 50% glycerol at -20°C .

Table 2: Recombinant Lnt Production Parameters

ParameterDetail
Expression HostE. coli BL21(DE3)
InductionIPTG (0.1–1 mM)
Yield~50 µg (per liter culture)
Purity>95% (SDS-PAGE)

Research Applications

  • ELISA Development: Recombinant Lnt serves as an antigen in diagnostic kits for detecting anti-Lnt antibodies or monitoring bacterial infections .

  • Structural Studies: Used in X-ray crystallography to elucidate conformational changes during catalysis .

  • Pathogenesis Research: Investigates Lnt’s role in lipoprotein maturation and virulence factor secretion .

Comparative Analysis with Other Bacterial Lnts

FeatureR. solanacearum LntE. coli LntMycobacterium Lnt
Acylation SiteN-terminal cysteineN-terminal cysteineN-terminal cysteine
Fatty Acid PreferenceC16 (inferred)C14–C18C16 + C19:0
Substrate SpecificityLipoproteinsLipoproteinsLipoproteins
Active Site DynamicsFlexible arm (predicted)Flexible armNot reported

Data synthesized from .

Research Gaps and Future Directions

  1. Fatty Acid Specificity: Direct characterization of acyl donors in R. solanacearum Lnt reactions.

  2. Structural Dynamics: Cryo-EM or NMR studies to confirm conformational changes during catalysis.

  3. Pathogenic Role: Linking Lnt activity to lipoprotein-dependent virulence mechanisms (e.g., T3SS effectors) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lnt; RSc0527; RS04941; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-523
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
lnt
Target Protein Sequence
MRALFSSPAADTAGQQEALAVPLARLRFAAPLAALLGVMHTLAFAPNRWWWLQILSLAGL AALVRQAPRLRDVAWVGYAFGLGWFLSGIWWLYISMHVYGDMPAWMAAAAVLLFSAYLAL HPALAAWLWQRLARGRQLSGAASALVFGAAWLVSEWLRGTEWTGFPWLNGGYAHTDGPLA GYAPLVGVYGVVAIAATLAGLLCAAAERRLHWLAGLAGVAVLAAGWPLHTIAWTQPVGKP ITVRLLQGNVPQDVKFQQTGIDHSLALYTKMVTEQPAQLVVTPETAFPILLQDMPQEIAL AIRTYVDTTGSSVLFGAANADSAVDYTNSAFGVGPWFKGVYRYDKHHLVPFGEFIPFGFH WFVHMMNMPLGDFRRGLPVQPPMPVAGQRVAPNICYEDLFGEEIAASLRQAERPATMLAN VTNLAWFGDTIALDQHLQISRMRALESGRPMLRATNTGATAVVRPDGSVQARLPVFTLGT LQADVQGMQGLTPFVRTGNAPALGAGVLVLLAALARRRRAGAA
Uniprot No.

Target Background

Function
Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links

KEGG: rso:RSc0527

STRING: 267608.RSc0527

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (Lnt) and what role does it play in Ralstonia solanacearum?

Apolipoprotein N-acyltransferase (Lnt) is an integral membrane enzyme that catalyzes the final step in bacterial lipoprotein post-translational modification. In Ralstonia solanacearum, as in other gram-negative bacteria, Lnt transfers an acyl chain from phospholipids to the α-amino group of the N-terminal diacylglyceryl-modified cysteine of apolipoproteins, resulting in mature triacylated lipoproteins . This process is essential for proper lipoprotein function, which may contribute to R. solanacearum's virulence, membrane integrity, and host-pathogen interactions during plant infection .

How is Ralstonia solanacearum classified taxonomically?

Ralstonia solanacearum belongs to Bacteria; Proteobacteria; β subdivision; Ralstonia group; genus Ralstonia . It is now recognized as part of the Ralstonia solanacearum species complex (RSSC) which can be divided into four phylotypes (I, II, III, and IV) based on sequence data from the 16S-23S rRNA gene spacer region, hrp and egl genes . These phylotypes reflect different geographical origins: Asian (phylotype I), American (phylotype IIA and IIB), African (phylotype III), and Indonesian (phylotype IV) . Each phylotype can be further subdivided into sequevars, with at least 55 sequence variants identified to date .

What are the main symptoms of diseases caused by Ralstonia solanacearum?

Ralstonia solanacearum causes bacterial wilt, characterized by a sudden wilting of the entire plant. When examining infected plants, stem cross-sections typically exude a slimy bacterial substance . In certain hosts, R. solanacearum causes specific diseases like Moko disease in banana and brown rot in potato, where visible bacterial colonization occurs in the fruit and tuber, respectively . The pathogen primarily attacks solanaceous plants worldwide, with particularly devastating effects in tropical and subtropical regions .

What is the basic mechanism of Lnt enzyme activity?

Lnt operates through a two-step ping-pong mechanism. First, the enzyme undergoes covalent modification in the presence of phospholipids, forming a thioester acyl-enzyme intermediate. In the second step, it transfers the acyl chain to the α-amino group of the N-terminal diacylglyceryl-modified cysteine of an apolipoprotein, creating a mature triacylated lipoprotein . This activity can be studied in vitro using purified enzyme and synthetic substrates like the diacylglyceryl-modified lipopeptide FSL-1 .

How can Ralstonia solanacearum lnt be cloned for recombinant expression?

To clone R. solanacearum lnt for recombinant expression, researchers should first identify the lnt gene sequence from available R. solanacearum genome data (e.g., GMI1000, FJAT-1458, RS-09-161, or other sequenced strains) . PCR amplification of the lnt gene using specific primers with appropriate restriction sites allows for insertion into expression vectors. Since Lnt is an integral membrane protein, expression systems like E. coli C41(DE3) or C43(DE3) that are optimized for membrane proteins are preferable . The recombinant plasmid should be verified using restriction digestion followed by gel electrophoresis to confirm proper insertion2. Sequential steps include:

  • Genomic DNA extraction from R. solanacearum

  • PCR amplification of the lnt gene with designed primers

  • Restriction digestion of both the PCR product and expression vector

  • Ligation of the digested products

  • Transformation into a suitable E. coli strain

  • Selection of transformants on appropriate antibiotics

  • Verification of recombinant plasmids through restriction digestion and gel electrophoresis2

  • Sequence confirmation of the cloned lnt gene

What are the optimal conditions for purifying recombinant Lnt from Ralstonia solanacearum?

Purification of recombinant R. solanacearum Lnt should consider its nature as an integral membrane protein. Based on established protocols for similar enzymes, the following purification strategy is recommended:

  • Express the His-tagged Lnt in an appropriate E. coli strain grown at lower temperatures (20-25°C) to enhance proper folding

  • Harvest cells and disrupt by sonication or French press in a buffer containing protease inhibitors

  • Solubilize membrane fractions using detergents such as n-dodecyl-β-D-maltoside (DDM) or Triton X-100

  • Purify using nickel affinity chromatography with imidazole gradient elution

  • Further purify by size exclusion chromatography to obtain homogeneous protein

Optimal purification conditions should be determined empirically, but maintaining the enzyme at 4°C throughout the purification process and including phospholipids or lipid-like molecules in buffers may help preserve enzyme activity . The purified enzyme should be assessed for its ability to form a thioester acyl-enzyme intermediate to confirm functional integrity.

How can the enzymatic activity of recombinant Lnt be measured in vitro?

The enzymatic activity of recombinant R. solanacearum Lnt can be measured using methods similar to those established for E. coli Lnt:

  • Thioester acyl-enzyme intermediate formation: Incubate purified enzyme with phospholipids like phosphatidylethanolamine and analyze by SDS-PAGE under non-reducing conditions to detect the intermediate .

  • Transfer assay using radiolabeled phospholipids: Incorporate [³H]-palmitate into phospholipids and measure transfer to apolipoprotein substrates by scintillation counting .

  • Mixed micelle assay: Create a mixed micelle system with detergent, phospholipids as acyl donors, and synthetic substrate like FSL-1 (diacylglyceryl-modified lipopeptide). After incubation, analyze products by mass spectrometry to detect N-acylation .

  • FRET-based assay: Design fluorescently labeled substrate peptides that change fluorescence properties upon acylation.

Kinetic parameters (Km, Vmax) can be determined by varying substrate concentrations and analyzing data according to ping-pong mechanism models .

How do Ralstonia solanacearum phylotypes and sequevars impact Lnt structure and function?

The genomic diversity observed across R. solanacearum phylotypes and sequevars (at least 55 identified to date) likely influences Lnt structure and function. Comparative genomic analysis of Lnt sequences from different R. solanacearum strains may reveal:

  • Conserved catalytic residues essential for enzyme function

  • Phylotype-specific variations that could influence substrate specificity

  • Adaptations related to host specialization

For example, strains from phylotype I (Asian origin) like sequevars 13, 14, 15, 17, 34, 44, 54, and 55 might exhibit Lnt variants adapted to specific host interactions. Researchers should perform multi-sequence alignments of Lnt from various sequevars and conduct structure-function predictions to identify critical residues. Site-directed mutagenesis experiments comparing activity of Lnt variants from different phylotypes could reveal evolutionary adaptations of this enzyme across the species complex.

What is the role of Lnt in Ralstonia solanacearum pathogenicity and host adaptation?

While not explicitly described in the provided search results, the role of Lnt in R. solanacearum pathogenicity can be hypothesized based on bacterial lipoprotein functions:

  • Lipoproteins often serve as pathogen-associated molecular patterns (PAMPs) recognized by plant immune systems

  • Proper lipoprotein modification by Lnt may be essential for type III secretion system (T3SS) function, which is crucial for R. solanacearum virulence

  • Lnt-modified lipoproteins might contribute to membrane integrity during plant colonization

Research approaches to investigate this relationship include:

  • Creating lnt knockout or conditional mutants in R. solanacearum

  • Comparing virulence of wild-type and lnt-mutant strains in various host plants

  • Analyzing plant immune responses to lipoproteins from wild-type vs. mutant bacteria

  • Examining membrane integrity and stress resistance in lnt-deficient strains

  • Investigating potential interactions between Lnt-modified lipoproteins and host factors

How does phospholipid composition affect Lnt activity in Ralstonia solanacearum?

The activity of Lnt depends significantly on phospholipid composition, as demonstrated for the E. coli enzyme which uses phosphatidylethanolamine as an acyl donor . For R. solanacearum Lnt, several research questions emerge:

  • Does R. solanacearum Lnt show phospholipid specificity similar to E. coli Lnt?

  • How do environmental conditions that alter bacterial membrane composition affect Lnt activity?

  • Can phospholipid composition changes during plant infection impact lipoprotein modification?

To investigate these questions, researchers could:

  • Test recombinant R. solanacearum Lnt activity with various phospholipids (phosphatidylethanolamine, phosphatidylglycerol, cardiolipin) in vitro

  • Analyze enzyme kinetics with different phospholipids using the mixed micelle assay

  • Compare membrane phospholipid composition of R. solanacearum under various growth conditions and during plant infection

  • Assess lipoprotein modification patterns in bacteria grown under conditions that alter membrane composition

What are common problems in expressing and purifying functional recombinant Lnt?

Expressing and purifying functional Lnt from R. solanacearum presents several challenges:

  • Low expression levels: As an integral membrane protein, Lnt may express poorly in standard systems. Solutions include using specialized E. coli strains (C41/C43), lower induction temperatures, and weaker promoters.

  • Protein aggregation: Membrane proteins often aggregate during overexpression. Adding mild detergents during cell lysis and subsequent purification steps is crucial.

  • Loss of activity during purification: Activity may be lost due to detergent effects or removal of essential lipids. Including phospholipids in purification buffers and testing multiple detergent types can help maintain activity.

  • Difficulty assessing purity and integrity: Standard protein analysis methods may be complicated by detergent presence. Use methods compatible with detergent-solubilized proteins such as fluorescence-detection size-exclusion chromatography.

  • Thioester intermediate stability: The thioester acyl-enzyme intermediate is susceptible to hydrolysis. Optimize buffer conditions (pH, temperature) to maintain stability during activity assays.

How can researchers develop specific inhibitors for Ralstonia solanacearum Lnt?

Developing specific inhibitors for R. solanacearum Lnt could provide tools for studying its function and potentially lead to new control strategies for bacterial wilt. Approaches include:

  • Structure-based design: If crystal structure is unavailable, create homology models based on related bacterial Lnt structures. Use in silico docking to identify potential binding sites and design candidate inhibitors.

  • High-throughput screening: Develop a fluorescence-based assay suitable for screening compound libraries. Focus on compounds that specifically inhibit R. solanacearum Lnt without affecting other acyltransferases.

  • Mechanism-based inhibitors: Design compounds that mimic the thioester intermediate transition state, potentially creating irreversible inhibitors.

  • Phospholipid analogs: Create non-hydrolyzable analogs of the natural phospholipid substrates that compete for the active site.

  • Validation assays: Test promising inhibitors in vitro against purified enzyme, then in bacterial cultures to assess effects on growth and lipoprotein modification.

How do you analyze and interpret contradictory data in Lnt functional studies?

When facing contradictory data in Lnt functional studies, consider:

  • Enzyme stability and assay conditions: Verify enzyme stability under the assay conditions. Contradictory results may stem from partial denaturation or proteolysis during preparation or assay.

  • Substrate quality and specificity: Ensure synthetic substrates or phospholipids are pure and structurally verified. Different substrate preparations may yield inconsistent results.

  • Detergent effects: Different detergents can significantly affect membrane protein activity. Systematically compare results across detergent types and concentrations.

  • Phylogenetic differences: If comparing Lnt from different R. solanacearum strains, consider phylotype-specific variations that might explain functional differences.

  • Methodological approach:

    • Use multiple, complementary assay methods

    • Implement appropriate controls for each experimental condition

    • Consider potential differences between in vitro and in vivo conditions

    • Validate findings with independent protein preparations

How might CRISPR-Cas9 genome editing be applied to study Lnt function in Ralstonia solanacearum?

CRISPR-Cas9 technology offers precise genome editing possibilities for studying Lnt in R. solanacearum:

  • Gene knockout studies: Create complete lnt gene knockouts to assess the essentiality of the gene and impact on virulence and survival.

  • Domain function analysis: Generate targeted mutations in specific functional domains to analyze their roles in enzyme activity.

  • Promoter modifications: Modify the native promoter to create conditional expression systems for studying Lnt function under different conditions.

  • Tagged protein expression: Insert epitope tags or fluorescent protein fusions at the genomic locus to study native expression levels and localization.

  • Regulatory element identification: Perform CRISPR interference (CRISPRi) to identify regulatory elements that control lnt expression.

Implementation challenges include developing efficient transformation protocols for various R. solanacearum strains and addressing potential off-target effects in this bacterium's diverse genome contexts.

What comparative genomic approaches could reveal evolutionary patterns in Lnt across Ralstonia species?

Comparative genomic approaches for studying Lnt evolution across Ralstonia species include:

  • Phylogenetic analysis: Construct phylogenetic trees based on Lnt sequences from diverse Ralstonia species and strains, including R. solanacearum and R. pseudosolanacearum , to identify evolutionary relationships.

  • Selection pressure analysis: Calculate dN/dS ratios across the lnt gene to identify sites under positive or purifying selection, potentially revealing functionally important regions.

  • Horizontal gene transfer assessment: Analyze GC content, codon usage, and flanking regions of lnt genes to detect potential horizontal transfer events.

  • Structure prediction comparison: Generate structural models of Lnt from different Ralstonia species to identify conserved structural features versus variable regions.

  • Correlation with host range: Analyze whether Lnt sequence variations correlate with host specificity patterns observed across the Ralstonia species complex.

This comparative approach could link Lnt evolution to the differing ecological and pathogenic adaptations observed between R. solanacearum (greater physiological and ecological adaptability) and R. pseudosolanacearum (greater pathogenic and biochemical adaptability) .

How might lipidomic approaches enhance our understanding of Lnt function in Ralstonia solanacearum?

Lipidomic approaches offer powerful tools to understand Lnt function in R. solanacearum:

  • Comprehensive lipoprotein profiling: Use mass spectrometry to characterize the complete lipoprotein profile of wild-type versus lnt-mutant R. solanacearum strains, identifying specific modification patterns.

  • Membrane phospholipid dynamics: Apply lipidomics to analyze changes in membrane phospholipid composition during different growth phases and infection stages, correlating with Lnt activity.

  • Acyl chain preference analysis: Determine if R. solanacearum Lnt shows preferences for specific acyl chain lengths or saturation levels by analyzing modified lipoproteins.

  • Environmental adaptation signatures: Compare lipoprotein modifications across R. solanacearum strains adapted to different hosts or environmental conditions to identify potential adaptation mechanisms.

  • Spatial organization studies: Combine lipidomics with subcellular fractionation to understand the spatial organization of Lnt activity within bacterial membrane domains.

These approaches would generate comprehensive datasets that could be integrated with genomic, transcriptomic, and phenotypic data to develop systems-level understanding of Lnt function in R. solanacearum pathogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.