Recombinant Ralstonia solanacearum DNA translocase FtsK 2 (ftsK2)

Shipped with Ice Packs
In Stock

Description

Research Applications

ftsK2 is pivotal in studying:

  • Chromosome segregation: Acts as a DNA pump during bacterial cytokinesis, resolving chromosomal dimers via interaction with XerCD recombinases .

  • Pathogenicity: Ralstonia solanacearum uses ftsK2-like systems for genome stability, which may influence host colonization and virulence .

  • Molecular mechanisms: Structural studies (e.g., crystallography, electron microscopy) reveal a rotary inchworm mechanism for DNA translocation .

Comparative Genomic Context

In Ralstonia solanacearum, ftsK2 is part of a broader genomic landscape critical for pathogenicity:

  • Pathogenicity factors: Includes type III secretion systems (T3SS), extracellular polysaccharides (EPS), and type II secretion systems (T2SS) .

  • Genomic heterogeneity: Strain-specific deletions (e.g., phylotype IIB-1) correlate with virulence differences, highlighting the importance of functional genomics .

Key Research Findings

  1. Structural Insights:

    • Hexamer formation: Electron microscopy confirmed DNA-dependent hexamers with a central channel for dsDNA .

    • Conformational changes: Crystallographic studies identified a RecA-like core undergoing structural shifts during ATP hydrolysis, enabling directional translocation .

  2. Functional Roles:

    • XerCD interaction: Activates site-specific recombination at the dif site during chromosome resolution .

    • Pathogenicity: Deletions in related genes (e.g., epsB, phcA) disrupt virulence, underscoring the protein’s indirect role in host interactions .

  3. Production Challenges:

    • Natural transformation: Efficient markerless gene deletion methods (e.g., FLP/FRT system) are used to study virulence factors in Ralstonia solanacearum .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ftsK2; RSc2341; RS01205; DNA translocase FtsK 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-781
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
ftsK2
Target Protein Sequence
MARASTTPTTRTDPAALPSRIGRLLGEVRWFLLLAVTIAFLTILLSYNKADPGWSHASQV DDVRNLGGRVGAWFADVLLFVFGASAYWWALLLLRRVWRGWRELMSDERVPRAATPRVDA GVTWFGFALILSASMGLEAIRMHTLHMKLPRAPGGVLGDLIGGSLQHALGFTGGTLLLLL MFTVGLSLFFHFSWLNLAEQIGAGVETLFVGFKTRRENKQDRAIGEAAKVEREEVVETRR VRIEEAPPVQIVRPAAVVKSERVEREKQQPLFVDIQDSDLPALALLDAVPPAQETVSAET LEFTSRLIEKKLKDFGVEVTVVAAYPGPVITRYEIEPATGVKGSQIVNLAKDLARSLSLV SVRVVETIPGKNCMGLELPNPKRQAVRLAEILGSQVYNESASQLTMALGKDIAGKPVVAD LAKMPHCMVAGTTGSGKSVGINAMILSLLYKARADAVRLILIDPKMLELSIYEGIPHLLC PVVTDMRQAGHALNWAVGEMERRYKLMSKMGVRNLAGFNKKIEEAAAREEKIHNPFSLTP DAPEPLDKLPMIVIVIDELADLMMVVGKKVEELIARIAQKARAAGIHLVLATQRPSVDVI TGLIKANVPTRIAFQVSSKIDSRTILDQQGAEALLGMGDMLYLAPGTGLPVRVHGAFVSD DEVHRVVENLKSQGEPNYIEGLLEGGTADGEGGGDGFGGGAGLAGGGAGEADPLYDQAVD VVLKNRRASISLVQRHLRIGYNRAARLLEDMEKAGLVSAMSGNGNREILAPNRNGNVVEE E
Uniprot No.

Target Background

Function
FtsK2 is an essential cell division protein that plays a crucial role in coordinating cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell division machinery. The C-terminus functions as a DNA motor that moves double-stranded DNA in an ATP-dependent manner towards the dif recombination site, which is located within the replication terminus region. Translocation halts specifically at Xer-dif sites, where FtsK interacts with the Xer recombinase, facilitating the activation of chromosome unlinking through recombination. FtsK orienting polar sequences (KOPS) guide the direction of DNA translocation. FtsK can remove proteins from DNA as it translocates, but translocation stops specifically at the XerCD-dif site, preventing the removal of XerC and XerD from dif.
Database Links

KEGG: rso:RSc2341

STRING: 267608.RSc2341

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How do researchers distinguish between the roles of FtsK2 and other cell division proteins in Ralstonia solanacearum?

Researchers employ several complementary approaches:

Genetic approaches:

  • Gene deletion studies comparing phenotypes of multiple divisome proteins

  • Construction of conditional mutants with inducible expression systems

  • Domain-specific mutations (e.g., inactivation of the DNA motor by mutation of the Walker A motif K971A)

Biochemical approaches:

  • Protein-protein interaction studies to map the divisome network

  • Purification of recombinant proteins for in vitro activity assays

  • ATP hydrolysis assays to assess translocase function

Microscopy approaches:

  • Fluorescence microscopy with protein fusions to visualize localization

  • Time-lapse imaging to track the dynamics of protein recruitment during cell division

  • Electron microscopy to examine septum formation defects

For example, in studies of FtsK homologs in Staphylococcus aureus, researchers distinguished cell splitting defects by analyzing cell morphology, where FtsK mutants showed characteristic tetrads of cells with impaired septum splitting that differed from phenotypes caused by other divisome proteins .

What methodologies are available for expressing and purifying recombinant FtsK2 from Ralstonia solanacearum?

Researchers typically employ the following protocols for recombinant expression and purification:

Expression systems:

  • E. coli-based expression: Most commonly using BL21(DE3) strain with pET-based vectors

  • Native expression: Using R. solanacearum's own expression machinery for authentic protein production

Expression optimization strategies:

ParameterOptimization approach
TemperatureTypically lowered to 16-20°C to enhance proper folding
InductionIPTG concentration 0.1-0.5 mM for T7-based systems
MediaRich media (LB) initially, minimal media for labeled protein
TimeExtended expression (16-24h) at lower temperatures
SupplementsAddition of ATP or ADP (1-5 mM) may stabilize protein

Purification workflow:

  • Affinity chromatography with N-terminal His-tag (as used for the commercially available version)

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography for final polishing

  • Storage in buffer containing glycerol (typically 6% as indicated in commercial preparations)

Special considerations:

  • The C-terminal domain can be expressed separately for DNA translocation studies

  • The membrane-spanning N-terminal domain requires detergent solubilization

  • Avoid freeze-thaw cycles as noted in commercial preparations

How can genetic manipulation techniques be optimized for studying FtsK2 function in Ralstonia solanacearum?

A comprehensive comparison of genetic manipulation methods for R. solanacearum reveals several optimized approaches:

Natural transformation-based methods:
The most efficient approach utilizes R. solanacearum's natural competence combined with the FLP/FRT recombination system :

  • Generate gene deletion fusion PCR fragments containing:

    • Upstream and downstream flanking regions of ftsK2

    • Antibiotic resistance gene (e.g., gentamicin) flanked by FRT sites

  • Transform R. solanacearum cells through natural transformation:

    • Culture cells in MM medium supplemented with 10% glycerol

    • Mix cells with PCR product on cellulose nitrate membrane

    • Incubate on CTG medium for 24h at 28°C

    • Select transformants on antibiotic plates

  • Remove the antibiotic marker using FLP recombinase:

    • Introduce plasmid expressing FLP under control of Pgdh promoter

    • Select colonies that lose gentamicin resistance but maintain kanamycin resistance

    • Subcultured selected colonies to eliminate the FLP plasmid

This method achieves transformation frequencies significantly higher than triparental mating or electroporation, with transformation frequencies ranging from 5×10^-8 to 45×10^-8 .

Comparative transformation efficiencies:

MethodTransformation frequencyAdvantagesLimitations
Natural transformation5-45×10^-8Highest efficiency, simple protocolStrain-dependent competence
ElectroporationLower than natural transformationWorks for many strainsRequires specialized equipment
Triparental matingLowest efficiencyWorks for non-competent strainsTime-consuming, less efficient

For conditional expression systems, researchers can use the strong constitutive promoter Pgdh, which has been successfully employed in R. solanacearum for expressing recombinant proteins .

What is the relationship between FtsK2 function and Ralstonia solanacearum pathogenicity?

The relationship between FtsK2 and pathogenicity involves several interconnected mechanisms:

Cell division coordination and bacterial fitness:
FtsK2's role in coordinating cell division directly impacts bacterial population dynamics during host colonization. Proper chromosome segregation ensures that dividing bacteria maintain genomic integrity during rapid proliferation within host tissues.

Potential links to virulence regulation:
While direct evidence linking FtsK2 to virulence is limited, research on R. solanacearum gene regulation networks suggests possible connections:

  • PhcA regulatory pathway: Studies have shown that mutations in PhcA, a global virulence regulator, affect R. solanacearum adaptation to acidic environments and swimming motility . FtsK2, as a central player in cell division, may interact with this pathway.

  • Transcriptional networks: Transcriptome profiling has identified defense-related genes in resistant vs. susceptible plants , including cell wall processing and hormone signaling components that could be influenced by proper bacterial cell division.

  • In planta fitness requirements: Genome-wide Tn-seq analysis has identified genes required for R. solanacearum survival in tomato plants . While FtsK2 was not specifically highlighted, the study methodology provides a framework for investigating its contribution to in planta fitness.

Experimental approaches to investigate this relationship:

  • Generate conditional ftsK2 mutants and assess virulence in plant infection assays

  • Compare transcriptomes of wild-type and ftsK2-depleted strains during plant infection

  • Identify potential interactions between FtsK2 and known virulence regulators using protein-protein interaction studies

How does FtsK2 in Ralstonia solanacearum compare to FtsK homologs in other bacterial species?

FtsK2 shows both conserved features and unique characteristics compared to homologs in other species:

Conserved features across bacterial FtsK proteins:

FeatureFunctionConservation
N-terminal domainDivisome assemblyModerate sequence conservation
Walker A/B motifsATP binding and hydrolysisHighly conserved
DNA translocase activityChromosome segregationFunctionally conserved
KOPS recognitionDirectional DNA movementPresent but sequences may vary

Species-specific differences:

  • Multiple FtsK homologs: Unlike E. coli, which has a single FtsK protein, R. solanacearum possesses multiple FtsK homologs (FtsK1, FtsK2), similar to Rhizobium meliloti which has two homologs (FtsZ1, FtsZ2) .

  • Structural variations: R. solanacearum FtsK2 is 781 amino acids long, whereas E. coli FtsK is 1329 amino acids, suggesting potential functional differences .

  • Functional specialization: In R. meliloti, FtsZ2 lacks the conserved C-terminal region present in other FtsZ proteins and appears non-essential for viability . This suggests possible functional divergence among FtsK homologs in R. solanacearum as well.

  • Phenotypic effects: Overproduction of R. meliloti FtsZ2 in E. coli causes some cells to coil dramatically, a phenotype not observed with FtsZ1 overproduction . This indicates potential novel functions for FtsK homologs in complex bacteria like R. solanacearum.

Researchers can leverage these differences to develop R. solanacearum-specific targeting strategies that might not affect beneficial soil bacteria.

What experimental challenges arise when studying FtsK2 in Ralstonia solanacearum under plant infection conditions?

Researchers face several challenges when investigating FtsK2 function during plant infection:

Technical challenges:

  • Conditional expression systems: Since FtsK2 is likely essential, constitutive knockouts may be lethal. Developing tightly regulated inducible systems that function in planta is challenging.

  • Visualization limitations: Tracking protein dynamics during infection requires specialized microscopy techniques compatible with plant tissue.

  • Environmental variability: Plant-bacterial interactions are influenced by numerous variables (temperature, humidity, plant age, microbial community) that affect experimental reproducibility.

Biological challenges:

  • Host-specific responses: R. solanacearum's behavior varies across host plants. Different isolates show varying degrees of virulence between tobacco varieties (e.g., 4411-3 vs. K326) , necessitating careful strain selection.

  • Temporal dynamics: Gene expression patterns change throughout infection stages. Transcriptome profiling reveals different sets of differentially expressed genes (DEGs) at different timepoints:

    • In highly resistant tobacco genotype: 6,133 DEGs at 10 days post-inoculation vs. only 134 DEGs at 17 days

    • In moderately resistant genotype: 12,679 DEGs at 10 days and 16,000 DEGs at 17 days

  • Signal interference: Plant defense responses can interfere with bacterial gene expression. For example, hormone accumulation patterns differ significantly between resistant and susceptible plants .

Methodological solutions:

  • Use soil amendment techniques to create controlled infection environments

  • Employ advanced microscopy methods like confocal laser scanning microscopy with plant-compatible mounting media

  • Develop microcosm experiments that simulate natural conditions while maintaining experimental control

  • Utilize Tn-seq methodologies to assess relative fitness contributions of genes during infection

How can structural biology techniques be applied to understand FtsK2 function in Ralstonia solanacearum?

Structural biology offers powerful approaches to elucidate FtsK2 function at the molecular level:

X-ray crystallography workflow:

  • Protein construct design: Create truncated versions focusing on:

    • The C-terminal DNA translocase domain (most amenable to crystallization)

    • The N-terminal transmembrane domain (requires detergent solubilization)

  • Expression optimization:

    • Use E. coli BL21(DE3) with T7-based expression vectors

    • Add His-tag for purification (N-terminal as in commercial versions)

    • Optimize temperature (16-20°C) and induction conditions

  • Crystallization screening:

    • Include ATP/ADP analogs to capture different conformational states

    • Test co-crystallization with short DNA fragments containing KOPS sequences

Cryo-electron microscopy (cryo-EM) applications:
Particularly valuable for studying the large, multi-domain FtsK2 structure and its interactions with DNA and divisome components.

Nuclear Magnetic Resonance (NMR) approaches:
Suitable for studying domain dynamics and protein-protein interactions within the divisome complex.

Complementary biophysical techniques:

TechniqueApplication for FtsK2 research
Small-angle X-ray scattering (SAXS)Low-resolution envelope of full-length protein
Hydrogen-deuterium exchange MSMapping protein-protein interaction surfaces
Single-molecule FRETReal-time DNA translocation dynamics
Atomic Force MicroscopyVisualizing FtsK2-DNA complexes

Structure-based functional studies:

  • Generate site-directed mutants based on structural insights

  • Develop small-molecule inhibitors targeting key functional sites

  • Investigate conformational changes during the ATP hydrolysis cycle

By combining structural and functional studies, researchers can develop a comprehensive understanding of how FtsK2 coordinates chromosome segregation and cell division in R. solanacearum.

What transcriptomic approaches can reveal FtsK2's role in the Ralstonia solanacearum gene regulatory network?

Transcriptomic approaches offer valuable insights into how FtsK2 integrates with R. solanacearum's gene regulatory networks:

RNA-Seq experimental design:

  • Conditional FtsK2 depletion: Using inducible systems to control FtsK2 expression levels

  • Time-course sampling: Capturing immediate and secondary effects of FtsK2 depletion

  • Condition variations: Testing multiple environmental conditions (minimal vs. rich media, acidic vs. neutral pH)

Comparative transcriptomics framework:

  • Conditional FtsK2 mutant vs. wild-type: Identifying genes directly or indirectly regulated by FtsK2

  • FtsK2 depletion vs. other divisome protein depletions: Distinguishing FtsK2-specific effects from general cell division defects

  • In vitro vs. in planta conditions: Revealing context-dependent regulatory roles

Integration with existing R. solanacearum transcriptome data:
Comparative transcriptome profiling has already identified:

  • 3,967 differentially expressed genes (DEGs) between resistant and susceptible tobacco varieties

  • 6,233 DEGs in highly resistant genotypes after R. solanacearum infection

  • 21,541 DEGs in moderately resistant genotypes after infection

Pathway analysis opportunities:
KEGG pathway analysis of DEGs in resistant R. solanacearum-infected plants has identified nine enriched pathways :

  • Plant-pathogen interaction

  • Alpha-linolenic acid metabolism

  • Protein processing in endoplasmic reticulum

  • MAPK signaling pathway

  • Amino sugar and nucleotide sugar metabolism

  • Endocytosis

  • Starch and sucrose metabolism

  • Glycerolipid metabolism

  • Glycerophospholipid metabolism

Researchers can investigate how FtsK2 depletion affects these pathways during infection, providing insights into its role in pathogenicity and stress adaptation.

Data integration strategies:

  • Network analysis to identify co-regulated gene clusters

  • Motif discovery to identify potential DNA binding sites

  • Integration with ChIP-seq data to map global regulatory networks

These approaches will position FtsK2 within the complex regulatory landscape of R. solanacearum and may reveal unexpected connections to virulence and adaptation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.