Recombinant Ralstonia solanacearum Hypersensitivity response secretion protein hrcU (hrcU)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant HrcU is a full-length, 357-amino acid protein (UniProt ID: P35652) expressed in Escherichia coli with an N-terminal histidine (His) tag for purification . Key production details include:

PropertySpecification
SpeciesRalstonia solanacearum
Expression HostE. coli
TagHis tag
Purity≥90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer, 6% trehalose, pH 8.0
ReconstitutionSterile water (0.1–1.0 mg/mL) with glycerol for stability

Domain Architecture

  • N-terminal: Transmembrane helices for membrane anchoring .

  • C-terminal: Cytosolic domain containing the conserved NPTH motif (Asn-Pro-Thr-His), which undergoes autocatalytic cleavage critical for T3SS function .

Mechanistic Role in T3SS

  • Secretion Control: HrcU interacts with HrpB2, a T3SS component, to regulate effector translocation .

  • Cleavage Dependency: Cleavage at the NPTH site modulates substrate specificity, enabling hierarchical secretion of translocon proteins (e.g., RipF1) and effectors .

HrcU VariantPhenotype
Wild-type HrcUSupports full T3SS activity and virulence
NPTH-site mutant (AAAH)Reduces effector secretion by 50–70%

Role in Pathogenicity

  • Virulence Loss: hrcU deletion mutants fail to cause wilting in tomato and Arabidopsis .

  • Plant Immune Evasion: HrcU-dependent T3SS suppresses host defenses like the hypersensitive response (HR) .

Key Interacting Partners

ProteinFunctionInteraction Outcome
HrpB2Inner rod component of T3SSStabilizes secretion apparatus
HpaPSubstrate specificity switchSequesters HrpJ to regulate effector delivery

Applications in Research

  • T3SS Mechanism Studies: Used to dissect secretion hierarchy and substrate switching .

  • Plant-Pathogen Interaction Models: Facilitates screening for T3SS inhibitors .

  • Structural Biology: Supports crystallography and mutagenesis studies of the NPTH motif .

Critical Studies

  1. Cleavage and Complementation:

    • HrcU cleavage is required for efficient effector secretion. Non-cleavable mutants (e.g., AAAH) reduce virulence but retain partial function .

    • hrcU mutants regain pathogenicity when complemented with wild-type HrcU but not with cleavage-deficient variants .

  2. Effector Translocation:

    • HrcU enables translocation of necrosis-inducing effectors (e.g., RipTPS) into plant cells .

StudyKey Result
HrpB2-HrcU Interaction HrcU C-terminal domain binds HrpB2 post-cleavage
hpaP Mutant Analysis HpaP deletion increases HrpJ secretion, altering effector delivery

Challenges and Future Directions

  • Stability Issues: Requires glycerol supplementation to prevent aggregation .

  • Functional Complexity: Interactions with regulators like PhcA and HrpG suggest overlapping regulatory networks .

  • Biotechnological Potential: Engineered HrcU variants could enable targeted disruption of T3SS in crop protection .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will prepare it accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life can be influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We aim to accommodate specified tag type requests. Please communicate your desired tag type, and we will strive to develop it preferentially.
Synonyms
hrcU; hrpN; RSp0864; RS01635; Hypersensitivity response secretion protein HrcU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
hrcU
Target Protein Sequence
MSDEKTEQPTDKKLEDAHRDGETAKSADLTAAAVLLSGCLLLALTASVFGERWRALLDLA LDVDSSRHPLMTLKQTISHFALQLVLMTLPVGFVFALVAWIATWAQTGVVLSFKPVELKM SAINPASGLKRIFSVRSMIDLVKMIIKGVAVAAAVWKLILILMPSIVGAAYQSVMDIAEI GMTLLVRLLAAGGGLFLILGAADFGIQRWLFIRDHRMSKDEVKREHKNSEGDPHIKGERK KLARELADEAKPKQSVAGAQAVVVNPTHYAVAIRYAPEEYGLPRIIAKGVDDEALALREE AAALGIPIVGNPPLARSLYRVDLYGPVPEPLFETVAEVLAWVGEMGASGTPGAEPQH
Uniprot No.

Target Background

Function
HrcU is involved in the secretion of PopA, a proteinaceous elicitor of the hypersensitivity response in plants.
Database Links

KEGG: rso:RSp0864

Protein Families
Type III secretion exporter family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of HrcU in the type III secretion system of Ralstonia solanacearum?

HrcU functions as an essential component of the type III secretion system (T3SS) in Ralstonia solanacearum, a critical apparatus that enables the bacterium to inject effector proteins directly into host cells. Similar to its homologs in other bacterial pathogens, R. solanacearum HrcU contains four transmembrane domains and a cytoplasmic C-terminal tail that are crucial for its function . The protein serves as an interface between the cytoplasmic and membrane-embedded components of the T3SS machinery, facilitating the recognition and subsequent secretion of effector proteins that promote bacterial pathogenicity. The gene encoding HrcU is part of the HrpB regulon, which is activated during plant infection to orchestrate the expression of virulence factors . The proper functioning of HrcU is essential for R. solanacearum to cause disease in host plants, as mutations in this protein can severely compromise pathogenicity.

How conserved is the HrcU protein across different bacterial plant pathogens?

The HrcU protein demonstrates remarkable conservation across various bacterial plant pathogens, particularly in its functional domains. Multiple sequence alignment analyses using T-Coffee software reveal that the NPTH motif (asparagine-proline-threonine-histidine) is highly conserved in HrcU homologs across plant and animal bacterial pathogens as well as in flagellar systems . This conservation extends beyond plant pathogens like Ralstonia solanacearum to include other economically significant pathogens such as Erwinia amylovora (the causative agent of fire blight). The strong conservation of the NPTH motif suggests its fundamental importance to protein function across diverse bacterial species. Additionally, the transmembrane topology and C-terminal cytoplasmic domain structure show significant similarities across these pathogens, indicating evolutionary pressure to maintain these functional elements for effective type III secretion system operation.

What experimental evidence demonstrates that HrcU is essential for pathogenicity?

Compelling experimental evidence establishes HrcU as essential for bacterial pathogenicity through several complementary approaches. In studies with Erwinia amylovora, researchers created a deletion mutant (Ea1189Δ hrcU) that exhibited complete loss of virulence when inoculated into immature pear fruits . Crucially, when wild-type hrcU was reintroduced on a plasmid (Ea1189Δ hrcU/pRRM1), pathogenicity was fully restored, demonstrating the direct relationship between functional HrcU and virulence. Even more specifically, point mutations targeting the conserved NPTH motif (such as the N266A substitution) abolished pathogenicity despite the presence of the protein, highlighting the critical nature of this specific domain . These experiments provide direct evidence that HrcU is not merely associated with pathogenicity but is functionally required for it. Similar results have been observed in Ralstonia solanacearum, where HrcU functions within the regulatory network controlled by HrpB, the master regulator of pathogenicity .

How does the NPTH motif in HrcU contribute to protein function and T3SS regulation?

The NPTH motif in HrcU serves as a critical autocleavage site that undergoes a conformational change essential for proper type III secretion system (T3SS) function. Research demonstrates that substitution of the asparagine residue with alanine (N266A) in this conserved motif abolishes pathogenicity without affecting protein expression . This mutation prevents the conformational changes required for HrcU to properly interact with other T3SS components. Mechanistically, the NPTH motif facilitates autocleavage that separates the N-terminal transmembrane region from the C-terminal cytoplasmic domain, allowing the protein to adopt different conformational states necessary for substrate recognition and secretion switching.

Protein interaction studies using yeast two-hybrid (Y2H) assays revealed that while HrcU-CT (the C-terminal domain of HrcU) strongly interacts with HrpP, this interaction is measurably reduced when the N266A mutation is introduced . Quantitative analysis using ImageJ software confirmed that this reduction in interaction is statistically significant. This suggests that the NPTH motif-mediated conformational changes in HrcU not only affect its own structure but also modulate its ability to interact with partner proteins, creating a molecular switch mechanism that regulates T3SS activity in response to environmental or host-derived signals.

HrcU VariantInteraction with HrpPPathogenicity in Pear Fruitα-galactosidase Activity
Wild-type HrcU-CTStrongYesHigh
HrcU-CT N266AReducedNoSignificantly lower
No HrcUNoneNoBackground levels

What is the relationship between HrpB regulation and HrcU function in Ralstonia solanacearum?

The relationship between HrpB regulation and HrcU function represents a sophisticated regulatory network in Ralstonia solanacearum pathogenicity. HrpB functions as a transcriptional activator that controls the expression of multiple genes associated with the type III secretion system (T3SS), including hrcU . This master regulator is induced during plant infection and responds to specific environmental signals that indicate host proximity. While HrpB directly controls hrcU transcription, the regulatory relationship extends beyond simple gene activation.

The HrpB regulon encompasses not only structural components of the T3SS machinery like HrcU but also effector proteins secreted through this system and additional factors that contribute to virulence . Research has identified an HrpB-activated operon of six genes responsible for synthesizing a fluorescent isatin derivative named HDF (HrpB-dependent factor) . This 149 Amu compound was purified from culture supernatants and its structure solved using NMR and CD spectroscopy. The presence of this secondary metabolite suggests that HrpB regulation extends beyond protein secretion to include small molecule production that may contribute to pathogenicity through alternative mechanisms. The integrated function of HrcU within this broader HrpB-controlled program highlights the multifaceted approach R. solanacearum employs during infection.

How do protein-protein interactions involving HrcU orchestrate type III secretion system assembly and function?

Protein-protein interactions involving HrcU play a central role in orchestrating both the assembly and dynamic function of the type III secretion system. Research using yeast two-hybrid (Y2H) assays has demonstrated that the C-terminal domain of HrcU (HrcU-CT) specifically interacts with HrpP, a soluble component of the T3SS apparatus . This interaction is functionally significant as both proteins are required for pathogenicity. The interaction between HrcU and HrpP appears to be influenced by the conformational state of HrcU, particularly around the NPTH motif region, suggesting that autoprocessing of HrcU modulates this protein-protein interaction.

The HrcU protein likely serves as an organizational hub within the T3SS complex, with its transmembrane domains anchoring it within the bacterial inner membrane while its cytoplasmic domain engages with soluble components. Based on homology with related systems, HrcU presumably interacts with additional proteins including:

  • Inner membrane components that form the core export apparatus

  • Cytoplasmic ATPases that energize the secretion process

  • Substrate proteins (effectors) awaiting secretion

  • Potential chaperones that deliver effectors to the secretion apparatus

These interactions create a dynamic secretion interface that can respond to environmental conditions and host signals. The conformational changes in HrcU mediated by the NPTH motif likely serve as a molecular switch that helps determine substrate specificity during different stages of infection, allowing the bacterium to secrete different sets of effector proteins as infection progresses .

What expression systems are most effective for producing recombinant HrcU protein for structural and functional studies?

Recombinant expression of HrcU presents distinct challenges due to its multiple transmembrane domains and autocleaving properties. Based on research approaches used with similar membrane proteins, the following expression systems offer particular advantages:

For structural studies requiring high protein yields, a dual approach is recommended. The cytoplasmic C-terminal domain (HrcU-CT) can be efficiently expressed in Escherichia coli BL21(DE3) using pET-based vectors with a hexahistidine tag for purification . This domain should be expressed separately from the transmembrane region to avoid solubility issues. Expression should be induced at lower temperatures (16-18°C) with reduced IPTG concentrations (0.1-0.5 mM) to enhance proper folding.

For full-length HrcU containing transmembrane domains, specialized E. coli strains designed for membrane protein expression (such as C41/C43(DE3) or Lemo21(DE3)) yield better results. Alternative expression systems like Pichia pastoris may provide advantages for full-length protein production when mammalian-like post-translational modifications are desired. For functional studies, an inducible system in a non-pathogenic Ralstonia strain offers a near-native environment that preserves protein-protein interactions.

The choice of detergents is critical when working with full-length HrcU, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) showing better preservation of protein structure and function during purification processes. When studying NPTH motif-dependent autocleavage, researchers should be aware that this processing may occur during expression, potentially resulting in separate N-terminal and C-terminal fragments in the purified product.

What mutagenesis approaches can be used to investigate the functional domains of HrcU?

Systematic investigation of HrcU functional domains requires a comprehensive mutagenesis strategy targeting conserved regions and predicted functional sites. Based on research with HrcU and homologous proteins, the following approaches have proven effective:

Site-Directed Mutagenesis: Targeting the conserved NPTH motif has provided significant insights into HrcU function. The N266A substitution in Erwinia amylovora HrcU demonstrated that this residue is essential for pathogenicity . A complete alanine-scanning mutagenesis of the NPTH motif and surrounding residues can systematically map the contribution of each amino acid to autocatalytic cleavage and protein function. Additionally, conservative substitutions (N→Q, T→S) can help determine the biochemical requirements of each position.

Domain Deletion Analysis: Construction of truncated variants lacking specific transmembrane domains or the C-terminal cytoplasmic region helps define the minimal functional units of HrcU. Research has shown that the C-terminal domain alone (HrcU-CT) can interact with partner proteins like HrpP in yeast two-hybrid assays . Systematic deletion analysis can further refine our understanding of domain-specific functions.

Random Mutagenesis: For identifying novel functional regions without prior assumptions, random mutagenesis using error-prone PCR followed by functional screening can reveal unexpected residues important for HrcU activity. This unbiased approach complements the targeted strategies described above.

After generating mutants, comprehensive phenotypic analysis should include:

  • Protein expression and stability assessment

  • Autocleavage efficiency evaluation

  • Protein-protein interaction studies (Y2H or pull-down assays)

  • Secretion system functionality tests

  • Pathogenicity assays in appropriate plant models

How can researchers effectively study the interactions between HrcU and other components of the type III secretion system?

Investigating the protein interaction network centered around HrcU requires a multi-method approach to capture both stable and transient interactions within the complex type III secretion system. Based on successful studies with HrcU and similar proteins, the following comprehensive strategy is recommended:

Yeast Two-Hybrid (Y2H) Analysis:
Y2H has been successfully employed to detect interactions between HrcU-CT and HrpP . When using this system, researchers should:

  • Express the C-terminal domain separately from transmembrane regions to avoid localization issues

  • Include appropriate controls to account for autoactivation

  • Use quantitative assays (e.g., α-galactosidase activity) to measure interaction strength

  • Validate findings with HrcU variants containing mutations in functional domains

Co-Immunoprecipitation (Co-IP) and Pull-Down Assays:
These methods validate Y2H findings in a more native context. For membrane-associated proteins like HrcU:

  • Use crosslinking agents (e.g., DSP or formaldehyde) to capture transient interactions

  • Employ mild detergents for membrane protein solubilization

  • Design epitope tags that don't interfere with protein function

  • Compare results from both N- and C-terminal tagged versions

Bacterial Two-Hybrid Systems:
As an alternative to Y2H, bacterial two-hybrid systems can provide a more native environment for bacterial proteins. The adenylate cyclase-based two-hybrid (BACTH) system is particularly suitable for membrane protein interactions.

In vivo Protein-Protein Interaction Analysis:
Förster Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC) can detect interactions in living bacterial cells, providing spatial and temporal information about HrcU interactions during infection.

Mass Spectrometry-Based Approaches:
Affinity purification coupled with mass spectrometry (AP-MS) offers an unbiased approach to identify the complete HrcU interactome. Techniques such as crosslinking MS (XL-MS) can provide additional structural information about interaction interfaces.

Biochemical Characterization:
Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC) enable quantitative measurement of binding affinities and kinetics between purified HrcU domains and partner proteins, providing insights into the hierarchical assembly of the secretion apparatus.

Interaction MethodAdvantagesLimitationsBest For
Yeast Two-HybridHigh-throughput, detects binary interactionsPotential false positives, artificial environmentInitial screening of interaction partners
Co-IP/Pull-DownMore native conditions, can detect complexesRequires good antibodies or tags, may miss weak interactionsValidating interactions in bacterial systems
Bacterial Two-HybridBacterial environment, suitable for membrane proteinsLower throughputConfirming interactions for bacterial proteins
FRET/BiFCIn vivo detection, spatial informationRequires protein fusion engineeringVisualizing interactions during infection
AP-MSUnbiased, detects multi-protein complexesComplex data analysis, indirect interactionsMapping the complete interactome
SPR/ITCQuantitative binding parametersRequires purified proteinsDetailed binding kinetics studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.