Recombinant Ralstonia solanacearum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mscL; RSc2930; RS00160; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
mscL
Target Protein Sequence
MALMQDFKKFAMRGNVIDLAVGVIIGAAFGKIVDSLVNDLIMPLVARIVGKLDFSNLFIQ LADAPAGVPQTLADLKKAGVPVFAYGNFITVAVNFLILAFIVFLMVRAITRVIDTNPPPA DTPENTLLLRDIRDSLKSKNQ
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a regulatory role in cellular osmotic pressure changes.
Database Links

KEGG: rso:RSc2930

STRING: 267608.RSc2930

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant R. solanacearum mscL?

E. coli expression systems have proven most effective for recombinant production of R. solanacearum mscL. The protein is typically expressed with an N-terminal His-tag to facilitate purification.

Recommended methodology:

  • Clone the full-length mscL gene (encoding amino acids 1-141) into a vector with a strong promoter

  • Transform into an E. coli strain optimized for membrane protein expression (C41/C43 derivatives or Lemo21)

  • Culture at lower temperatures (16-25°C) after induction to reduce inclusion body formation

  • Use mild detergents for extraction (DDM, LDAO, or OG) to maintain protein structure

  • Purify using Ni-NTA affinity chromatography followed by size exclusion chromatography

Typical yield markers:

  • Purity >90% as determined by SDS-PAGE

  • Functional activity confirmed by reconstitution into liposomes

What are the optimal storage conditions for recombinant R. solanacearum mscL?

Maintaining protein stability is critical for functional studies of mscL. Based on experimental evidence and standard protocols for membrane proteins:

Storage ParameterRecommended ConditionNotes
Temperature-20°C to -80°CLong-term storage
Buffer compositionTris/PBS-based, pH 8.0Contains 6% trehalose as stabilizer
Physical stateLyophilized powderMost stable form
Working solution4°CStable for up to one week
Freeze-thaw cyclesAvoidAliquot before freezing

Methodology for reconstitution:

  • Centrifuge vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration

  • Prepare working aliquots to avoid repeated freeze-thaw cycles

How can researchers verify the functional integrity of purified R. solanacearum mscL?

Several complementary approaches can verify that purified mscL retains its native conformation and function:

  • Electrophysiological characterization:

    • Reconstitute protein into planar lipid bilayers or giant liposomes

    • Measure single-channel conductance and gating threshold using patch-clamp techniques

    • Compare with published values for mechanosensitive channels (typically 2-3 nS)

  • Structural verification:

    • Circular dichroism spectroscopy to assess secondary structure content

    • Size-exclusion chromatography to confirm oligomeric state (pentameric for mscL)

    • Negative-stain electron microscopy to visualize channel complexes

  • Functional assays:

    • Fluorescent dye release from mscL-reconstituted liposomes under osmotic downshock

    • Patch-fluorometry coupling channel activity with fluorescence measurements

    • Complement mscL-deficient bacterial strains and test for osmotic shock survival

What methods can be used to study the structure-function relationship of R. solanacearum mscL?

Understanding structure-function relationships requires integration of structural data with functional measurements:

  • Site-directed mutagenesis approach:

    • Target conserved residues identified through sequence alignment with well-characterized mscL homologs

    • Focus on transmembrane domains and residues lining the pore

    • Introduce single amino acid substitutions (alanine scanning or charge substitutions)

    • Assess impact on channel gating, conductance, and ion selectivity

  • Domain swapping experiments:

    • Create chimeric channels by exchanging domains between R. solanacearum mscL and E. coli mscL

    • Express in E. coli MscL-knockout strains

    • Test for complementation and altered gating properties

  • Structural analysis workflow:

    • Purify to homogeneity (>95% purity)

    • Reconstitute in lipid nanodiscs or amphipols for structural studies

    • Apply cryo-electron microscopy or X-ray crystallography

    • Generate structural models in both closed and open states

How can isothermal titration calorimetry be applied to study interactions of R. solanacearum mscL?

Isothermal titration calorimetry (ITC) provides valuable thermodynamic data about protein-ligand interactions:

Experimental protocol:

  • Sample preparation:

    • Desalt protein samples using 7K molecular weight cut-off desalting columns

    • Dilute to 20 μM in Dulbecco's phosphate-buffered saline (DPBS)

  • ITC measurement setup:

    • Add 20 μM solution of recombinant mscL to the sample cell

    • Perform titration with ten 4 μL injections (0.4 μL first injection) of potential binding partner

    • Maintain temperature at 25°C using a MicroCal PEAQ-ITC instrument

  • Data analysis:

    • Fit data to a single site binding model

    • Analyze using appropriate software (e.g., MicroCal PEAQ-ITC Analysis Software)

    • Perform experiments in triplicate for statistical validity

  • Complementary validation:

    • Surface plasmon resonance competition assay

    • Microscale thermophoresis

How can R. solanacearum mscL be employed for controlled molecular delivery into cells?

The large pore size of mscL (>25 Å) makes it an excellent candidate for controlled delivery of membrane-impermeable molecules into cells:

Implementation protocol:

  • Vector design:

    • Clone R. solanacearum mscL into a mammalian expression vector

    • Add fluorescent tag (e.g., GFP) for visualization

    • Include inducible promoter for controlled expression

  • Cell engineering:

    • Transfect target cells with the expression construct

    • Select stable transformants

    • Verify membrane localization by confocal microscopy

  • Channel activation strategies:

    • Membrane tension: Osmotic downshock or mechanical stretch

    • Charge-induced activation: Introduce charged residues at key positions

    • Light-activated gating: Couple with photosensitive moieties

    • Chemical activation: Engineer chemical sensitivity

  • Cargo delivery applications:

    • Fluorescent dyes for proof-of-concept

    • Cell-impermeable drugs

    • Peptides (e.g., phalloidin for actin labeling)

    • Small proteins or nucleic acids

What are the key differences between R. solanacearum mscL and other bacterial mechanosensitive channels?

Comparative analysis provides insights into evolutionary adaptations and functional specialization:

FeatureR. solanacearum mscLE. coli mscLOther MS Channels
Amino acid length141 aa136 aaVariable (100-400 aa)
Gating threshold[Research gap]~10-12 mN/mVariable
Conductance[Research gap]~3 nSFrom 0.1-3 nS
Oligomeric stateLikely pentamericPentamericVaries (MscS: heptameric)
pH sensitivity[Research gap]ModerateVariable

Research methodology for comparative studies:

  • Multiple sequence alignment to identify conserved and divergent regions

  • Homology modeling based on crystallized homologs

  • Heterologous expression in standardized systems for direct comparison

  • Electrophysiological characterization under identical conditions

  • Functional complementation in bacterial strains lacking endogenous channels

How might horizontal gene transfer influence the evolution of mscL in the R. solanacearum species complex?

R. solanacearum shows extensive evidence of horizontal gene transfer (HGT) and recombination:

  • Analytical approach:

    • Apply multilocus sequence analysis (MLSA) across R. solanacearum strains

    • Use computational methods to detect recombination events

    • Compare phylogenetic trees of mscL with species phylogeny to detect incongruences

  • Key findings from R. solanacearum genomic studies:

    • Multiple recombination events have been detected across lineages

    • Phylotype IV serves as a gene donor for majority of recombination events

    • Phylotype I (affecting the most hosts) appears most recombinogenic

    • 21 recombination events identified within and across lineages

  • Implications for mscL evolution:

    • Channel adaptations may transfer between strains adapted to different environments

    • Recombination could accelerate adaptive evolution in new ecological niches

    • Phenotypic diversity in channel properties might reflect genetic exchange

What role might mscL play in R. solanacearum pathogenicity and environmental persistence?

As a soil-borne plant pathogen, R. solanacearum must navigate diverse osmotic environments during its lifecycle:

  • Research approaches to investigate mscL's role:

    • Generate mscL knockout mutants in different R. solanacearum phylotypes

    • Compare wildtype and mutant strains for:

      • Survival under osmotic stress conditions

      • Ability to colonize plant tissues

      • Persistence in soil and water

      • Biofilm formation capacity

  • Pathogenicity connections:

    • R. solanacearum transitions between soil (10³-10⁶ CFU/g) and plant tissues (10⁸ CFU/g)

    • Bacteria experience osmotic shifts when moving from soil to xylem vessels

    • MscL may function in adaptation to these varying environments

  • Environmental persistence factors:

    • R. solanacearum can remain viable in water or soil for years

    • Osmoregulation likely contributes to this remarkable persistence

    • MscL could provide protection during sudden environmental changes

How does mscL expression correlate with the transcriptional program of R. solanacearum during infection?

Transcriptomic studies have revealed infection-specific gene expression patterns:

  • Analysis of transcriptome data:

    • During root colonization, 422 genes were differentially expressed compared to growth on rich medium

    • Metabolic activities were mostly repressed during early root colonization

    • Virulence determinants including Type Three Secretion System (T3SS) were induced

  • Research approach to investigate mscL expression:

    • Extract RNA from bacteria during different infection stages

    • Perform RT-qPCR targeting mscL transcripts

    • Use fluorescent transcriptional reporters to visualize expression in planta

    • Compare expression in different plant tissues and under varying osmotic conditions

  • Integration with stress response pathways:

    • Correlate mscL expression with other stress-responsive genes

    • Investigate regulatory elements in mscL promoter region

    • Determine if known R. solanacearum regulators (HrpG, HrpB, PhcA) affect mscL expression

How do strain-specific variations in mscL correlate with R. solanacearum phylotypes and host range?

The R. solanacearum species complex exhibits remarkable diversity with different phylotypes, sequevars, and host ranges:

  • Systematic analysis methodology:

    • Sequence mscL genes from strains representing all phylotypes (I-IV)

    • Correlate sequence variations with phylogenetic relationships

    • Identify amino acid substitutions that might affect channel function

    • Express variants in standardized systems for functional comparison

  • Phylotype-specific characteristics:

    • Phylotype I: Widespread, affects diverse hosts, highly recombinogenic

    • Phylotype IIB: More clonal, includes potato-specific strains

    • Phylotype III: Found at higher altitudes in tropical areas

    • Phylotype IV: Most divergent, appears ancestral

  • Host adaptation analysis:

    • Compare mscL sequences from strains with different host preferences

    • Test for selection signatures in channel sequences

    • Investigate whether mutations in mscL correlate with host specialization or environmental adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.