Recombinant Ralstonia solanacearum Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have specific format requirements, please indicate them in your order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery timelines may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice packaging, please communicate this in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
msbA; RSc2200; RS01399; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-592
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
msbA
Target Protein Sequence
MAVTSSSSSQPPAASQPGHFKRLWAYLRPELSSFILAMVAMGVVAATEGIIPKVVKDLLD QGFGGEYAGKLWRVPAMLVGIAVVRGVAQFGATYFLSLVSNKVLLNLRMKMFERLLQAPA AFYQRNTAASLINAVIFEVNQVLQVLTGVFITLVRDSMTVLALLIFLFYTNWRLTLVVAV ILPVIGFLMSRINRRLRSLNREHQNLTNEAAYVVEEAAGGYKVVKLHGGEAYESRRFNAM TNRLRGYAMRMAVAGGLNQPVTQFLAALALSVILAIAMVQAQANQTTVGGFTGFVMAMLL LISPLKHLTDVNQPMQRGLTAAEFIFGLIDTPIEPQDGGKHIDRARGDLRFEHVTFRYGP DGRAALDSIDLHVKAGEIVALVGPSGSGKTTLVNLLPRFFEPTSGRIVLDGDALADLSLQ DLRRQIAFVSQDVVLFNDTIAANVAYGARDASEIDMARVRRALEAAYLTDVVDNLPDGVD TNIGDNGSKLSGGQRQRLAIARAVYKDAPILILDEATSALDSESERQVQAALEALMQGRT TLVIAHRLSTIENADRIVVLEHGQIVEAGTHRELLDRDGLYAGLHRIQFATQ
Uniprot No.

Target Background

Function
This protein is involved in the biosynthesis of lipopolysaccharide (LPS). It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMDs) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: rso:RSc2200

STRING: 267608.RSc2200

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of MsbA in Ralstonia solanacearum?

MsbA in Ralstonia solanacearum functions as an essential ATP-binding cassette (ABC) transporter that facilitates the translocation of lipid A and lipopolysaccharide from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane. This protein operates as a lipid flippase, crucial for the proper assembly of the outer membrane in this gram-negative plant pathogen . The MsbA-mediated transport of lipid A represents a critical step in the lipopolysaccharide biogenesis pathway. This process is essential for bacterial viability and directly contributes to the pathogenicity of R. solanacearum, which causes bacterial wilt in over 200 plant species .

How does R. solanacearum MsbA structure compare to homologs in other bacterial species?

While the specific crystal structure of R. solanacearum MsbA has not been fully characterized based on the provided search results, comparative analysis can be made with the structure of MsbA from Salmonella typhimurium, which has been resolved at 2.8 Å resolution . Both proteins likely share structural similarities as ATP-binding cassette transporters, featuring:

  • A transmembrane domain with a portal that accommodates lipid A entry

  • Nucleotide-binding domains that bind and hydrolyze ATP

  • Conformational states that alternate between inward-facing and outward-facing orientations during the transport cycle

The full-length R. solanacearum MsbA consists of 592 amino acids with a specific sequence that determines its functional properties . Researchers investigating structural differences should focus on the transmembrane helices and the periplasmic surface cleft, where lipid A binding has been observed in homologous proteins .

What is the relationship between MsbA function and R. solanacearum pathogenicity?

R. solanacearum is a soil-borne bacterium causing bacterial wilt, a devastating disease affecting numerous plant species, including economically important crops . The pathogenicity of R. solanacearum depends on multiple virulence factors, with extracellular polysaccharide (EPS) being a major contributor . While MsbA does not directly produce EPS, its function in transporting lipid A and lipopolysaccharide components is critical for:

Disruption of MsbA function would likely compromise bacterial viability and virulence, making it a potential target for disease management strategies aimed at controlling bacterial wilt .

What are the optimal conditions for expressing recombinant R. solanacearum MsbA protein?

Based on successful recombinant production protocols, researchers should consider the following methodology for expressing R. solanacearum MsbA:

  • Expression system: Use E. coli as the heterologous expression host, which has proven effective for producing full-length MsbA protein (1-592 amino acids) .

  • Vector design: Incorporate an N-terminal His-tag for purification purposes, ensuring the tag does not interfere with the protein's functional domains .

  • Expression conditions:

    • Induce expression at OD600 of 0.6-0.8

    • Lower temperature to 18-20°C after induction to enhance proper folding

    • Extend expression time to 16-18 hours for membrane proteins

    • Include osmolytes like glycerol (0.5-2%) to stabilize the protein during expression

  • Cell lysis and membrane preparation:

    • Use gentle lysis methods to preserve membrane integrity

    • Isolate membrane fractions by ultracentrifugation

    • Solubilize MsbA using appropriate detergents (DDM, LMNG, or other mild detergents suitable for membrane proteins)

These conditions may require optimization depending on specific experimental goals and equipment availability.

How can researchers effectively purify recombinant MsbA while maintaining its functional integrity?

Purification of recombinant MsbA from R. solanacearum requires careful handling to maintain the protein's native conformation and activity:

  • Affinity chromatography:

    • Use Ni-NTA resin for His-tagged MsbA

    • Include detergent in all buffers at concentrations above the critical micelle concentration

    • Add 10-20% glycerol to stabilize the protein

    • Consider including ATP/ADP in buffers to stabilize nucleotide-binding domains

  • Buffer composition:

    • Tris/PBS-based buffer, pH 8.0

    • Include 6% trehalose as a stabilizing agent

    • Add reducing agents like DTT or β-mercaptoethanol (0.5-2 mM)

  • Further purification:

    • Size exclusion chromatography to remove aggregates

    • Verify protein homogeneity by SDS-PAGE (>90% purity)

  • Storage recommendations:

    • Store at -20°C/-80°C in small aliquots

    • Avoid repeated freeze-thaw cycles

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol for long-term storage

What methods are available for assessing the functional activity of purified R. solanacearum MsbA?

Researchers can employ several complementary approaches to assess MsbA functionality:

  • ATPase activity assays:

    • Measure ATP hydrolysis rates using colorimetric phosphate detection

    • Compare basal and lipid-stimulated ATPase activity

    • Assess the effects of known ABC transporter inhibitors

    • Determine temperature and pH optima for enzymatic activity

  • Lipid flippase assays:

    • Reconstitute MsbA into proteoliposomes with fluorescently labeled lipid analogues

    • Monitor transmembrane movement of lipids using fluorescence quenching techniques

    • Quantify lipid A transport specifically using radiolabeled substrates

  • Binding studies:

    • Isothermal titration calorimetry to measure binding affinities for lipid A

    • Surface plasmon resonance to assess interactions with potential inhibitors

    • Fluorescence anisotropy to monitor conformational changes upon substrate binding

  • Structural integrity assessment:

    • Circular dichroism spectroscopy for secondary structure analysis

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to probe for properly folded domains

How can structural data be used to design specific inhibitors targeting MsbA in R. solanacearum?

Structure-based inhibitor design for R. solanacearum MsbA should focus on:

  • Identifying key binding sites:

    • The transmembrane portal where lipid A enters the protein

    • The large amplitude opening in the inward-facing conformation

    • The periplasmic surface cleft where lipid A has been observed

    • The nucleotide-binding domains responsible for ATP hydrolysis

  • Computational approaches:

    • Homology modeling based on the S. typhimurium MsbA structure (2.8 Å resolution)

    • Molecular docking to identify potential binding pockets

    • Molecular dynamics simulations to account for protein flexibility

    • Virtual screening of compound libraries against identified binding sites

  • Rational design strategies:

    • Design compounds that mimic lipid A structure but cannot be transported

    • Target the conformational changes required for the transport cycle

    • Develop allosteric inhibitors that lock the protein in specific conformations

    • Create ATP-competitive inhibitors specific to the nucleotide-binding domains

  • Validation methods:

    • In vitro binding and inhibition assays

    • Bacterial growth inhibition studies

    • Resistance development monitoring

    • Structure-activity relationship analysis to optimize lead compounds

What are the challenges in studying conformational changes of MsbA during the lipid A transport cycle?

Investigating the dynamic conformational changes of MsbA during transport presents several technical challenges:

  • Membrane protein dynamics limitations:

    • Capturing intermediates in the transport cycle is difficult due to their transient nature

    • Traditional structural methods often require static, stable conformations

    • The lipophilic environment affects protein behavior in ways difficult to reproduce in vitro

  • Methodological approaches to overcome these challenges:

    • Single-molecule FRET to monitor distance changes between labeled residues

    • Hydrogen-deuterium exchange mass spectrometry to map conformational flexibility

    • Cryo-electron microscopy to capture multiple conformational states

    • Disulfide crosslinking to trap specific conformations

    • Molecular dynamics simulations to model the complete transport cycle

  • Specific considerations for R. solanacearum MsbA:

    • Engineer cysteine-free variants as backgrounds for introducing reporter cysteines

    • Design constructs with strategically placed fluorophores or spin labels

    • Develop native-like membrane mimetics that support the complete transport cycle

    • Create fusion proteins that can be locked in specific conformational states

How might variations in lipid A structure affect recognition and transport by MsbA in R. solanacearum?

This question addresses a fundamental aspect of substrate specificity:

  • Structure-function relationships in lipid A recognition:

    • The "trap and flip" model suggests MsbA recognizes specific features of lipid A

    • The transmembrane cavity must accommodate the bulky structure of lipid A

    • Electron density attributed to lipid A has been observed in structural studies

  • Experimental approaches to study substrate specificity:

    • Transport assays using lipid A variants with modified acyl chains

    • Competition assays between wild-type lipid A and modified versions

    • Site-directed mutagenesis of residues lining the substrate-binding pocket

    • Molecular dynamics simulations of lipid A-MsbA interactions

  • Comparative analysis with other gram-negative bacteria:

    • R. solanacearum lipid A may have species-specific modifications

    • These modifications could affect recognition efficiency by MsbA

    • Heterologous expression studies can test cross-species substrate compatibility

What strategies can address protein aggregation issues when working with recombinant R. solanacearum MsbA?

Membrane protein aggregation represents a common challenge:

  • Prevention strategies during expression:

    • Lower induction temperature to 16-18°C

    • Reduce inducer concentration

    • Co-express with molecular chaperones

    • Include chemical chaperones in the growth medium

  • Solubilization optimization:

    • Screen multiple detergents (DDM, LMNG, GDN, etc.)

    • Test detergent mixtures for improved extraction

    • Optimize detergent:protein ratios

    • Include lipids during solubilization to stabilize native conformations

  • Purification modifications:

    • Add stabilizing agents such as trehalose (6%)

    • Include substrate or substrate analogs during purification

    • Maintain glycerol concentrations of 5-50%

    • Remove aggregates through size exclusion chromatography

    • Utilize on-column refolding techniques

  • Storage and handling considerations:

    • Avoid repeated freeze-thaw cycles

    • Store in small aliquots at -80°C

    • Use appropriate reconstitution protocols

    • Consider reconstitution into nanodiscs or liposomes for enhanced stability

How can researchers distinguish between direct and indirect effects when studying potential MsbA inhibitors?

This methodological question addresses a critical aspect of inhibitor validation:

  • Control experiments:

    • Test effects on unrelated membrane proteins to rule out general membrane disruption

    • Compare with known ABC transporter inhibitors with established mechanisms

    • Use inactive structural analogs as negative controls

    • Evaluate dose-response relationships for specificity patterns

  • Mechanistic validation:

    • Demonstrate direct binding using techniques like surface plasmon resonance

    • Perform competition assays with known substrates or inhibitors

    • Assess effects on isolated steps in the transport cycle (ATP binding, hydrolysis, etc.)

    • Conduct resistance studies to identify compensatory mutations in MsbA

  • Cellular context considerations:

    • Monitor effects on lipid A transport specifically versus general cellular processes

    • Assess membrane integrity using appropriate dyes and assays

    • Compare effects in wild-type versus MsbA-depleted or mutant strains

    • Evaluate transcriptional responses to distinguish stress responses from direct inhibition

  • Analytical approaches:

    • Use radiolabeled substrates to directly measure transport inhibition

    • Employ thermal shift assays to confirm direct binding

    • Monitor conformational changes using intrinsic tryptophan fluorescence

    • Conduct competitive binding studies with varying inhibitor concentrations

What are the limitations of current diagnostic methods for detecting R. solanacearum strains based on MsbA characteristics?

While MsbA itself is not typically used as a diagnostic target for R. solanacearum detection, understanding its limitations in this context is valuable:

  • Current diagnostic approaches for R. solanacearum:

    • Loop-mediated isothermal amplification (LAMP) targeting other genes (e.g., fliC)

    • Immunocapture using EPS-specific monoclonal antibodies

    • PCR-based methods with various sensitivities

    • Cell-SELEX (systematic evolution of ligands by exponential enrichment) for developing specific aptamers

  • Challenges in using MsbA as a diagnostic target:

    • High conservation of ABC transporter domains across species

    • Limited sequence variation among R. solanacearum strains

    • Technical difficulties in detecting membrane proteins directly

    • Need for protein extraction methods compatible with field samples

  • Potential improvements:

    • Develop MsbA-specific molecular beacons for direct detection

    • Identify strain-specific epitopes in the variable regions of MsbA

    • Create recombinant antibodies targeting R. solanacearum-specific MsbA regions

    • Combine MsbA detection with other biomarkers for improved specificity

Diagnostic MethodTargetSensitivitySpecificity for R. solanacearumField Applicability
LAMPfliC geneHighHighGood
Immunocapture-PCREPSEnhancedHighModerate
Cell-SELEX AptamersCell surfaceHighRace-specificPotential
Molecular BeaconsLAMP productsHighHighGood
Theoretical MsbA-basedMsbA proteinUnknownPotentially limitedChallenging

How might understanding MsbA function in R. solanacearum contribute to developing novel plant disease management strategies?

This forward-looking question addresses the translational potential of MsbA research:

  • Target-based antimicrobial development:

    • MsbA is essential for bacterial viability, making it a promising antibiotic target

    • Structure-based design of specific inhibitors could lead to new bactericides

    • Inhibitors that disrupt lipid A transport would compromise bacterial outer membrane integrity

    • Species-selective inhibitors could target plant pathogens while sparing beneficial soil bacteria

  • Host resistance enhancement strategies:

    • Understanding how plant immune systems recognize bacterial surface components

    • EPS from R. solanacearum serves as a specific elicitor of defense responses in wilt-resistant tomato plants

    • Potential for developing plant varieties that better recognize lipopolysaccharide components

    • Engineering of plant receptors to detect specific signatures of pathogen membrane components

  • Diagnostic applications:

    • Development of improved detection methods for early disease diagnosis

    • Using MsbA-specific signatures for strain identification and tracking

    • Applying molecular techniques like LAMP with enhanced specificity for field diagnostics

    • Creating biosensors based on lipid A transport mechanisms

  • Evolutionary considerations:

    • Tracking MsbA variations across R. solanacearum strains with different host specificities

    • Understanding how newly emerging strains adapt their lipid transport mechanisms

    • Predicting resistance development to MsbA-targeting antimicrobials

What research approaches could elucidate the role of MsbA in R. solanacearum adaptation to different plant hosts?

This complex question addresses evolutionary and ecological aspects:

  • Comparative genomics and transcriptomics:

    • Sequence MsbA from multiple R. solanacearum strains with different host ranges

    • Compare expression patterns across infection of different host plants

    • Identify single nucleotide polymorphisms associated with host specificity

    • Analyze selection pressures on different MsbA domains

  • Experimental evolution:

    • Subject R. solanacearum to serial passages in different plant hosts

    • Monitor changes in MsbA sequence and expression

    • Conduct competition assays between strains with different MsbA variants

    • Test the fitness consequences of engineered MsbA mutations

  • Structure-function studies:

    • Create chimeric MsbA proteins with domains from different strains

    • Assess how specific mutations affect substrate specificity

    • Determine the impact of MsbA variations on outer membrane composition

    • Investigate how lipid A modifications correlate with MsbA sequence changes

  • Host-pathogen interaction studies:

    • Examine how different plant hosts respond to purified lipopolysaccharides

    • Investigate whether resistant plants recognize specific features transported by MsbA

    • Test how MsbA variations affect recognition by plant immune receptors

    • Determine if MsbA function correlates with the species' ability to overcome plant resistance

What biophysical techniques show promise for understanding the conformational dynamics of MsbA during lipid A transport?

Advanced biophysical approaches are critical for elucidating transport mechanisms:

  • Cutting-edge structural methods:

    • Time-resolved cryo-electron microscopy to capture transport intermediates

    • Solid-state NMR to study MsbA in native-like membrane environments

    • Serial femtosecond crystallography with X-ray free-electron lasers

    • Integrative structural biology combining multiple experimental data sources

  • Single-molecule techniques:

    • High-speed atomic force microscopy to visualize conformational changes in real-time

    • Single-molecule FRET with strategically placed fluorophores

    • Nanopore-based electrical recordings of individual transport events

    • Magnetic tweezers to apply force and study mechanical properties

  • Spectroscopic approaches:

    • EPR spectroscopy with site-directed spin labeling

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • Vibrational spectroscopy to probe local environments during transport

    • Time-resolved fluorescence to monitor substrate binding and release

  • Computational methods:

    • Enhanced sampling molecular dynamics simulations

    • Markov state modeling of the complete transport cycle

    • Machine learning approaches to predict conformational transitions

    • Quantum mechanics/molecular mechanics studies of ATP hydrolysis coupling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.