Recombinant Ralstonia solanacearum Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate your request in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; RSc0004; RS01826; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-553
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
yidC
Target Protein Sequence
MDIKRTILWVIFSLSVVLLFDNWQRANGHQSMFFPTPQTVTTTAAAPGGTPAGDVPKAAA PAAAGSQAAPATGAVSQTPASEKIVVTTDVIRATVDTAGAIVTKLELLTQKDHDGNPMVL FDRSLERTYLARSGLIGGDFPNHTTVFTASAGPRDLGTGGEVSLTLTADKGGAKLAKTYV FKRGSYVIDTRFDVTNDGAAPINPTLYMELARDGGAVEQSRFYSTFTGPAVYTDTDHYHK ITFADIDKSKAHVPAPTDSGWVAMVQHYFASAWIPAASAKREFYVDRIDTNFYRVGMQQA LGTVAPGASVSATARLFAGPQEERMLEGITPGLELVKDYGWLTIIAKPLFWLLEKIHKLL GNWGWSIVALTVLVKLVFFPLSATSYRSMAKMKDLQPRMTAIRERHKGDPQKMNQEMMTL YRTEKVNPLGGCLPIVIQIPVFIALYWVLLSSVEMRGAPWLGWVHDLASPDPFYILPILM AVSMFVQTRLNPTPPDPVQAKMMMFMPIAFSVMFFFFPAGLVLYWVVNNCLSIAQQWSIN RMLGTNKKAAAAK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links

KEGG: rso:RSc0004

STRING: 267608.RSc0004

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of YidC insertase in Ralstonia solanacearum?

YidC in R. solanacearum functions as a specialized membrane protein insertase that catalyzes the insertion of specific proteins into the prokaryotic plasma membrane. Unlike the Sec translocase which operates as a transmembrane channel that laterally opens to accommodate hydrophobic segments of substrate proteins, YidC interacts with its substrates in a groove-like structure at an amphiphilic protein-lipid interface . This structural arrangement allows the transmembrane segments of substrate proteins to slide directly into the lipid bilayer .

In bacterial systems, YidC operates strictly in a cotranslational mode, binding to nascent polypeptides as they emerge from the ribosome and facilitating their insertion into the membrane . The primary functions of YidC include:

  • Direct insertion of certain membrane proteins independently

  • Coordination with SecYEG during insertion of membrane components, particularly those associated with respiratory chain complexes

  • Facilitation of protein folding within the membrane environment

  • Translocation of small protein segments (soluble domains) into the periplasm

To experimentally verify YidC function in R. solanacearum, researchers typically employ gene knockout approaches followed by complementation studies with recombinant YidC variants to assess the resulting phenotypes and membrane protein composition.

How does the structure of YidC facilitate membrane protein insertion?

YidC spans the inner bacterial membrane with six transmembrane helices, with five helices forming the functional core of the protein . The most distinctive structural feature of YidC is a positively charged hydrophilic groove that remains open to the cytosolic side of the membrane . This unique structural arrangement creates a specialized microenvironment at the membrane interface that facilitates protein insertion through the following mechanism:

  • The hydrophilic groove provides an initial binding surface for the hydrophilic N-terminal region of the substrate protein

  • The substrate's hydrophilic segment is first translocated to the periplasmic side of the membrane

  • This positioning then allows the following hydrophobic segment to slide along the transmembrane helices of YidC into the lipid bilayer

The recently published high-resolution structures of YidC provide critical mechanistic insights into how transmembrane proteins achieve the energetically challenging transition from an aqueous environment in the cytoplasm to the hydrophobic lipid bilayer environment of the membrane .

To study YidC structure-function relationships experimentally, researchers typically use site-directed mutagenesis to modify key residues within the hydrophilic groove, followed by functional assays to assess the impact on substrate insertion efficiency.

What are the known substrate proteins for YidC in bacterial systems?

While the complete substrate profile of YidC in R. solanacearum is still being characterized, studies in model bacteria like E. coli have identified several membrane proteins that depend on YidC for insertion. The known substrates include:

SubstrateFunctionInsertion Dependency
ATP synthase subunit CEnergy metabolismYidC-dependent
MscLMechanosensitive channelYidC-dependent
TssLType VI secretion system componentYidC-dependent
Pf3 coat proteinBacteriophage componentYidC-dependent
M13 coat proteinBacteriophage componentYidC-dependent
TatCSubunit of Tat translocaseYidC/Sec coordinated
Respiratory complexesEnergy metabolismYidC/Sec coordinated

These substrates represent only a small fraction of membrane proteins inserted via YidC, as its main role appears to be coordinated action with SecYEG during the insertion of components of respiratory chain complexes .

To identify YidC substrates experimentally in R. solanacearum, researchers typically employ comparative proteomics approaches, comparing the membrane proteome of wild-type strains with yidC deletion or depletion mutants, followed by verification through in vitro insertion assays.

What methods are most effective for generating recombinant YidC in R. solanacearum?

Generating recombinant YidC in R. solanacearum requires careful consideration of several methodological approaches. Based on recent advances in R. solanacearum genetic manipulation, the following protocol is recommended:

  • Natural transformation approach: This method has demonstrated significantly higher transformation frequencies compared to traditional approaches like triparental mating and electroporation . For recombinant YidC expression:

    • Design fusion PCR fragments incorporating the yidC gene with desired modifications

    • Include an antibiotic resistance marker flanked by FRT sites for selection

    • Deliver the PCR products directly into R. solanacearum cells through natural transformation

    • Culture cells in minimal medium (MM) supplemented with glycerol to enhance transformation efficiency

  • Transformation efficiency considerations:

    • Natural transformation using PCR products provides transformation frequencies that are orders of magnitude higher than plasmid-based methods

    • Culture medium significantly impacts transformation efficiency, with minimal media containing glycerol yielding optimal results

    • DNA concentration should be optimized (typically around 1 μg per transformation) for maximum efficiency

  • Gene tagging strategies:

    • For functional studies, incorporate C-terminal tags (e.g., His6 or FLAG) that minimally interfere with YidC structure

    • For localization studies, consider fluorescent protein fusions inserted at permissive sites

This approach allows for precise genetic manipulation of the yidC gene, enabling the introduction of specific mutations, deletions, or tags for functional and structural studies.

How can natural transformation be optimized for yidC manipulation in R. solanacearum?

Optimization of natural transformation specifically for yidC manipulation in R. solanacearum requires attention to several critical parameters:

  • Culture conditions optimization:

    • R. solanacearum cells should be grown at 28°C for 2 days in minimal medium (MM) supplemented with 10% glycerol

    • The growth medium significantly impacts transformation efficiency, with cells cultured in MMG medium showing substantially higher transformation rates than those grown in LB or CTG media

    • Cell density should be carefully controlled, with mid-log phase cultures yielding optimal competence

  • DNA preparation and delivery:

    • PCR-generated DNA fragments show higher transformation efficiency than plasmid DNA

    • For yidC manipulation, prepare fusion PCR products containing:
      a) 800-1000 bp upstream homology region of yidC
      b) The modified yidC sequence or appropriate antibiotic marker
      c) 800-1000 bp downstream homology region

    • Use approximately 1 μg of purified PCR product per transformation

    • Spread the mixture on a cellulose nitrate membrane on CTG medium and incubate at 28°C for 24 hours

  • Transformation frequency assessment:

    • Calculate transformation frequency as the number of transformants observed per R. solanacearum cell applied

    • Expect frequencies in the range of 10^-7 to 10^-8 for successful transformations

A table comparing different transformation methods for R. solanacearum:

MethodRelative EfficiencyAdvantagesLimitations
Natural transformationHighestSimple procedure, PCR products can be used directlyRequires naturally competent cells
ElectroporationMediumWorks with various DNA typesLower efficiency, requires specialized equipment
Triparental matingLowestWorks with non-competent strainsComplex procedure, low efficiency

By optimizing these parameters, researchers can achieve efficient genetic manipulation of the yidC gene in R. solanacearum for subsequent functional and structural studies.

What experimental approaches can determine YidC-substrate interactions in R. solanacearum?

Investigating YidC-substrate interactions in R. solanacearum requires a multi-faceted experimental approach:

  • In vivo crosslinking:

    • Incorporate photo-activatable or chemical crosslinkers at specific positions within YidC

    • Expose cells to crosslinking conditions during active protein synthesis

    • Isolate crosslinked complexes via affinity purification

    • Identify interaction partners using mass spectrometry

    • This approach captures transient interactions during the insertion process

  • Co-purification studies:

    • Express tagged versions of YidC (e.g., His-tagged) in R. solanacearum

    • Solubilize membranes using mild detergents that preserve protein-protein interactions

    • Perform affinity purification under conditions that maintain native complexes

    • Identify co-purifying proteins by mass spectrometry or western blotting

    • This method identifies stable YidC-substrate complexes

  • Reconstituted systems:

    • Purify recombinant YidC from R. solanacearum

    • Reconstitute YidC into proteoliposomes

    • Add in vitro translated potential substrate proteins

    • Assess insertion efficiency through protease protection assays or fluorescence-based methods

    • This approach allows for controlled assessment of direct YidC-substrate interactions

  • Genetic approaches:

    • Generate conditionally depleted YidC strains in R. solanacearum

    • Perform comparative proteomics to identify membrane proteins dependent on YidC

    • Validate candidates through directed mutagenesis and in vitro insertion assays

    • This approach identifies physiologically relevant YidC substrates

These methods can be combined to generate a comprehensive understanding of YidC's substrate specificity and insertion mechanism in R. solanacearum.

How does YidC coordinate with the Sec translocase in R. solanacearum?

The coordination between YidC and the Sec translocase in R. solanacearum represents a complex interplay that facilitates efficient membrane protein insertion:

  • Molecular basis of coordination:

    • YidC likely interacts directly with the lateral gate of SecY, similar to what has been observed in other bacterial systems

    • This interaction creates a protected environment for membrane proteins exiting the Sec channel

    • YidC assists in the folding and assembly of multi-spanning membrane proteins as they emerge from the SecYEG channel

    • This coordination is particularly important for components of respiratory chain complexes

  • Experimental approaches to study YidC-Sec coordination:

    • Generate strains with tagged versions of both YidC and SecY components

    • Perform co-immunoprecipitation studies to assess physical interactions

    • Use crosslinking approaches to capture transient interactions during protein insertion

    • Employ cryo-electron microscopy to visualize the YidC-SecYEG supercomplex

    • Develop in vitro reconstituted systems containing both YidC and SecYEG for mechanistic studies

  • Functional significance in R. solanacearum:

    • The YidC-Sec coordination likely plays a crucial role in the assembly of membrane protein complexes involved in virulence

    • Disruption of this coordination could impact the bacterial envelope integrity, potentially affecting pathogenicity

    • Understanding this coordination mechanism may reveal targets for antimicrobial development

To experimentally dissect this coordination, researchers can use genetic approaches to create conditional mutants affecting the interaction interface between YidC and SecY, followed by functional assays to assess the impact on membrane protein insertion and bacterial fitness.

How do mutations in yidC affect R. solanacearum virulence and fitness?

The relationship between YidC function and R. solanacearum pathogenicity represents an important area of investigation:

  • Experimental approach to generating yidC mutants:

    • Use natural transformation with PCR-generated fragments to create site-specific mutations in yidC

    • For complementation studies, introduce unmarked mutations using the FLP/FRT recombination system to remove antibiotic markers

    • Create conditional depletion strains since complete deletion may be lethal

    • Generate point mutations in critical functional residues based on structural information

  • Phenotypic characterization:

    • Assess growth rates under different environmental conditions

    • Measure biofilm formation capacity

    • Quantify exopolysaccharide production, which is critical for R. solanacearum virulence

    • Evaluate motility and chemotaxis, which impact host colonization

    • Perform plant infection assays to directly measure virulence

  • Molecular analysis:

    • Use comparative proteomics to identify changes in the membrane proteome

    • Assess the composition and activity of respiratory chain complexes

    • Measure expression of virulence genes through qRT-PCR

    • Analyze membrane integrity and permeability using fluorescent dyes

By systematically characterizing yidC mutants, researchers can establish the connection between YidC-mediated membrane protein insertion and R. solanacearum pathogenicity, potentially revealing new targets for disease control strategies.

What purification methods are most effective for recombinant YidC from R. solanacearum?

Purifying recombinant YidC from R. solanacearum presents unique challenges due to its hydrophobic nature and membrane localization. The following methodology is recommended:

  • Expression strategies:

    • Express YidC with an N- or C-terminal affinity tag (His8 or Strep-tag II)

    • Consider using a fusion partner that enhances solubility (e.g., MBP, SUMO)

    • Use an inducible promoter system to control expression levels

    • For expression in R. solanacearum, utilize natural transformation with a construct containing a modified yidC gene

  • Membrane extraction:

    • Harvest cells and disrupt using French press or sonication

    • Separate membranes by ultracentrifugation

    • Carefully solubilize membranes using mild detergents:

      • n-Dodecyl β-D-maltoside (DDM, 1-2%)

      • Lauryl maltose neopentyl glycol (LMNG, 0.5-1%)

      • Digitonin (1-2%) for preserving native interactions

  • Purification procedure:

    • Perform affinity chromatography as the initial purification step

    • Follow with size exclusion chromatography to remove aggregates

    • Consider ion exchange chromatography as an additional purification step

    • Maintain detergent above critical micelle concentration throughout

  • Quality assessment:

    • Verify purity using SDS-PAGE and western blotting

    • Assess protein stability through thermal shift assays

    • Confirm functionality through reconstitution and substrate insertion assays

    • Analyze secondary structure using circular dichroism spectroscopy

This systematic approach enables the isolation of pure, stable, and functional YidC that can be used for structural studies and in vitro functional assays.

What are the best methods for measuring YidC insertion activity in vitro?

Measuring YidC insertion activity requires carefully designed in vitro assays that recapitulate the membrane insertion process:

  • Proteoliposome reconstitution assay:

    • Purify recombinant YidC from R. solanacearum using the methods described above

    • Reconstitute YidC into liposomes composed of E. coli polar lipids or synthetic lipid mixtures

    • Prepare substrate proteins through in vitro translation, preferably with a fluorescent or radiolabeled tag

    • Incubate translated substrates with YidC-containing proteoliposomes

    • Assess insertion through protease protection assays, where properly inserted transmembrane domains are protected from externally added proteases

  • Real-time fluorescence assays:

    • Engineer substrate proteins with environmentally sensitive fluorophores

    • Monitor fluorescence changes as the labeled domain transitions from aqueous to lipid environment

    • This approach provides kinetic information about the insertion process

    • Time-resolved measurements can reveal intermediates in the insertion pathway

  • Electrical measurements in planar lipid bilayers:

    • Reconstitute YidC into planar lipid bilayers

    • For channel-forming substrate proteins, measure conductance changes during insertion

    • This approach is particularly useful for electrophysiological characterization of inserted membrane proteins

  • Analytical considerations:

    • Include appropriate controls (liposomes without YidC, heat-inactivated YidC)

    • Optimize buffer conditions (pH, salt concentration, temperature) for R. solanacearum YidC

    • Consider the effect of membrane composition on insertion efficiency

    • Quantify insertion rates under varying substrate and YidC concentrations to determine kinetic parameters

These methodologies provide complementary information about YidC insertion activity and can be adapted to investigate specific aspects of the insertion mechanism.

How can structural biology approaches advance our understanding of R. solanacearum YidC?

Advanced structural biology techniques offer powerful tools for elucidating the molecular details of YidC function in R. solanacearum:

This multi-faceted structural biology approach can provide unprecedented insights into the insertion mechanism of YidC and its species-specific features in R. solanacearum.

What are the implications of YidC research for developing strategies against R. solanacearum infection?

Research on YidC in R. solanacearum has significant potential for developing novel strategies to combat this devastating plant pathogen:

  • YidC as a therapeutic target:

    • Identify small molecules that specifically inhibit R. solanacearum YidC function

    • Screen for compounds that disrupt YidC-substrate interactions

    • Develop peptide-based inhibitors that compete with natural substrates

    • Create structure-based designed inhibitors targeting the hydrophilic groove

  • Genetic approaches for disease resistance:

    • Engineer plants to express proteins that interfere with YidC function

    • Develop RNA interference strategies targeting yidC expression

    • Use CRISPR-based antimicrobials specifically targeting the yidC gene

    • Screen for natural plant compounds that modulate YidC activity

  • Diagnostic applications:

    • Develop antibodies or aptamers specific to R. solanacearum YidC for detection

    • Create biosensors for early detection of bacterial infection based on YidC-substrate interactions

    • Use species-specific features of YidC for rapid identification of R. solanacearum strains

  • Experimental considerations:

    • Validate YidC essentiality in R. solanacearum under various environmental conditions

    • Assess the impact of YidC inhibition on bacterial fitness and virulence

    • Evaluate the specificity of targeting strategies to avoid effects on beneficial microorganisms

    • Test efficacy in greenhouse and field conditions

By understanding the fundamental biology of YidC in R. solanacearum, researchers can develop targeted approaches to disrupt critical membrane protein insertion processes required for bacterial survival and pathogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.