Recombinant Ralstonia solanacearum NADH-quinone oxidoreductase subunit A (nuoA)

What is the functional role of NADH-quinone oxidoreductase subunit A (nuoA) in Ralstonia solanacearum?

NADH-quinone oxidoreductase subunit A (nuoA) is a critical component of the respiratory chain in Ralstonia solanacearum. It functions as part of Complex I (NDH-1), which catalyzes the transfer of electrons from NADH to quinones in the bacterial membrane, coupled with proton translocation across the membrane. This process is essential for energy production in R. solanacearum .

The nuoA protein (119 amino acids) contains transmembrane domains that anchor the NADH dehydrogenase complex to the bacterial membrane. The amino acid sequence (MNLEAYFPVLLFIIIGVGLGLALMTIGRILGPNNPDPDKLSPYECGFEAFEDARMKFDVRYYLIAILFILFDLETAFLFPWGVALRDIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE) indicates its hydrophobic nature, consistent with its membrane-embedded function .

Research suggests that respiratory chain components, including nuoA, play crucial roles in bacterial survival within host plants, as demonstrated by studies identifying related components (such as NADH-quinone oxidoreductase subunit B) as essential for R. solanacearum pathogenicity in tomato plants .

How does Ralstonia solanacearum NADH-quinone oxidoreductase compare to similar enzymes in other bacterial pathogens?

NADH-quinone oxidoreductases in bacterial respiratory chains can be classified into three main types:

• Type I (NDH-1): Proton-translocating, multi-subunit complex

• Type II (NDH-2): Single subunit, non-proton translocating

• Na+-translocating NADH:quinone oxidoreductase

R. solanacearum possesses Type I NADH-quinone oxidoreductase (NDH-1), which shares structural and functional similarities with other bacterial pathogen complexes but may exhibit unique characteristics related to its adaptation to plant hosts .

Comparative analysis across prokaryotes shows diverse NADH oxidation strategies:

• Some organisms possess only one type of NADH dehydrogenase

• Others have two types of NADH dehydrogenases

• Some contain all three types of NADH dehydrogenases

What makes R. solanacearum particularly interesting is its adaptation to the nutritionally limiting xylem environment of plants, where efficient energy metabolism is critical for survival and pathogenesis. Studies have shown that genes encoding respiratory chain components, including NADH-quinone oxidoreductase subunits, are among those required for bacterial survival in planta .

What are the structural characteristics of recombinant nuoA protein from Ralstonia solanacearum?

Recombinant Ralstonia solanacearum NADH-quinone oxidoreductase subunit A (nuoA) protein exhibits the following structural characteristics:

The protein contains hydrophobic regions consistent with its role as a membrane-embedded component of the NADH:quinone oxidoreductase complex. These transmembrane domains are essential for anchoring the complex to the bacterial membrane and facilitating electron transport. When expressed recombinantly with an N-terminal His-tag, the protein maintains its structural integrity while allowing for purification using affinity chromatography techniques .

Why is Ralstonia solanacearum significant in plant pathology research?

Ralstonia solanacearum is a soil-borne bacterial plant pathogen of exceptional significance in plant pathology for several reasons:

• Broad host range: R. solanacearum infects more than 250 plant species across 200 families, including economically important crops such as potatoes, tomatoes, bananas, tobacco, and ornamental plants like geraniums .

• Worldwide distribution: The pathogen has a broad geographic distribution and can survive in tropical, subtropical, and some temperate regions, making it a global threat to agriculture .

• Disease severity: As the causal agent of bacterial wilt disease, R. solanacearum can cause complete crop loss in susceptible hosts. The bacterium invades through plant roots, colonizes the xylem vessels, and causes systemic infection leading to wilting and plant death .

• Classification complexity: The species exhibits remarkable genetic diversity, organized into phylotypes, sequevars, and historically into races and biovars. Race 3 biovar 2 (R3bv2) strains are particularly concerning as they can thrive in temperate climates and cause brown rot of potato and southern wilt of geranium .

• Model organism status: It has become "the main plant pathogenic model in the beta-Proteobacteria class" due to its genetic tractability and the availability of its genome sequence .

The study of R. solanacearum respiratory chain components, including nuoA, contributes to understanding how this pathogen obtains energy during infection and colonization of plant tissues, potentially leading to new control strategies .

What role does the respiratory chain play in the pathogenicity of Ralstonia solanacearum?

The respiratory chain plays a crucial role in R. solanacearum pathogenicity through several mechanisms:

• Energy provision for invasion and colonization: The respiratory chain, including NADH-quinone oxidoreductase complexes, generates ATP necessary for bacterial motility, growth, and production of virulence factors during plant invasion .

• Adaptation to xylem environment: The plant xylem, where R. solanacearum proliferates, is a nutritionally limiting and dynamically changing habitat. Efficient energy metabolism through respiratory chain components helps the bacterium survive in this hostile environment .

• Support for virulence factor expression: Genome-wide identification studies have revealed that genes involved in "energy production and conversion," including NADH-quinone oxidoreductase subunit B (RS_RS10340), are required for survival in tomato plants .

• Environmental flexibility: The respiratory chain allows R. solanacearum to adapt to changing oxygen levels and nutrient availability during different stages of infection, from soil survival to plant colonization .

• Biofilm formation: Energy derived from respiratory metabolism supports the production of extracellular polymeric substances that contribute to biofilm formation and vascular occlusion during disease development .

Research using Tn-seq analysis has directly demonstrated that disruption of respiratory chain components significantly reduces the in planta fitness of R. solanacearum, confirming their importance in pathogenesis .

How can recombinant nuoA be utilized to study the mechanism of bacterial wilt disease progression?

Recombinant nuoA protein serves as a valuable tool for investigating bacterial wilt disease progression through multiple research approaches:

• Antibody production and immunolocalization: Purified recombinant nuoA can be used to generate specific antibodies for tracking the expression and localization of respiratory chain components during different stages of infection. This allows researchers to visualize the spatiotemporal dynamics of energy metabolism during disease progression .

• Protein-protein interaction studies: Tagged recombinant nuoA can facilitate pull-down assays and co-immunoprecipitation experiments to identify interaction partners within the NADH:quinone oxidoreductase complex and with other bacterial or plant proteins during infection .

• Structure-function analysis: Site-directed mutagenesis of recombinant nuoA, followed by complementation studies in nuoA-deficient mutants, can reveal critical amino acid residues required for respiratory chain function during plant colonization .

• Inhibitor screening: Recombinant nuoA can be used in biochemical assays to screen for compounds that specifically inhibit its function, potentially leading to new control strategies for bacterial wilt .

• Comparative analysis across strains: Expressing recombinant nuoA from different R. solanacearum phylotypes and sequevars allows researchers to investigate how variations in respiratory chain components contribute to differences in virulence and host range .

Studies have shown that genes involved in energy production, including respiratory chain components, are required for R. solanacearum survival in tomato plants. By manipulating nuoA expression or function, researchers can dissect the role of energy metabolism in different stages of the infection process .

What methodologies are most effective for studying nuoA function in the context of plant infection?

Multiple complementary methodologies can effectively investigate nuoA function during plant infection:

• Insertional mutagenesis: Creating precise nuoA knockout mutants through homologous recombination or CRISPR-Cas9 techniques, followed by plant inoculation assays to assess the impact on virulence. This approach has successfully identified respiratory chain components required for in planta survival .

• Conditional expression systems: Developing inducible or repressible nuoA expression systems to control nuoA levels during different infection stages, revealing temporal requirements for nuoA function .

• Real-time imaging: Using fluorescently labeled bacteria with wild-type or mutant nuoA to track colonization patterns in planta through confocal microscopy, providing insights into how respiratory chain function affects tissue invasion .

• Transcriptome and proteome analysis: Comparing gene and protein expression profiles between wild-type and nuoA mutant strains during infection to identify downstream effects of respiratory chain disruption .

• Metabolic flux analysis: Measuring changes in bacterial metabolism in wild-type versus nuoA mutants to quantify the impact on energy production and utilization during plant colonization .

• In vitro to in planta transition studies: Examining changes in nuoA expression when bacteria transition from soil or culture media to the plant environment, revealing adaptation mechanisms .

A Tn-seq approach has proven particularly powerful for genome-wide identification of genes required for in planta survival, demonstrating that components of the respiratory chain are critical for R. solanacearum pathogenicity .

How does the genetic diversity of Ralstonia solanacearum impact the structure and function of nuoA across different strains?

The genetic diversity of Ralstonia solanacearum has significant implications for nuoA structure and function across different strains:

• Phylogenetic variation: R. solanacearum is classified into four phylotypes (I-IV) based on genetic analysis. Phylotype I strains (now classified as R. pseudosolanacearum) and phylotype II (R. solanacearum sensu stricto) may exhibit differences in nuoA sequence and potentially function .

• Selection pressure: Analysis of the evolutionary dynamics of R. solanacearum has revealed that genes essential for species survival, including those involved in basic cellular functions like energy metabolism, are generally under purifying selection to maintain their function .

• Host adaptation: Different R. solanacearum strains have adapted to distinct host plants and environmental conditions. These adaptations may include modifications to respiratory chain components like nuoA to optimize energy production in specific host environments .

• Recombination events: Research has demonstrated significant levels of recombination within the R. solanacearum species complex, particularly in phylotype I strains, which could affect nuoA and other respiratory genes .

A comparative analysis of nuoA sequences across the R. solanacearum species complex would reveal:

Understanding these variations is critical for developing broadly effective control strategies targeting respiratory chain components .

What insights can be gained from comparing nuoA with other NADH-quinone oxidoreductase subunits in Ralstonia solanacearum?

Comparative analysis of nuoA with other NADH-quinone oxidoreductase subunits provides several important insights:

• Complex assembly and function: By comparing nuoA with other subunits like nuoB (RS_RS10340) and nuoK (Q8XXR1), researchers can understand how different components interact to form the functional respiratory complex. Studies have shown that nuoB is required for survival in tomato plants, suggesting a critical role for the entire complex .

• Differential expression patterns: Analysis of expression data can reveal whether all subunits are coordinately regulated or if some, like nuoA, respond differently to environmental signals during infection .

• Evolutionary conservation: Comparing sequence conservation across subunits highlights functionally critical regions. For example, nuoA (119 amino acids) and nuoK (101 amino acids) both contain transmembrane domains but may have different levels of sequence conservation across strains .

• Structural relationships: Understanding how nuoA relates structurally to other subunits provides insights into complex assembly and potential intervention points. The amino acid sequences of different subunits reveal their specialized functions:

• Target prioritization: Comparative analysis helps identify which subunits might be the most effective targets for intervention based on conservation, essentiality, and accessibility .

Studies using Tn-seq have identified NADH-quinone oxidoreductase subunit B as required for in planta survival, suggesting that multiple components of this complex are critical for pathogenicity .

What are the challenges and solutions in expressing and purifying functional recombinant nuoA?

The expression and purification of functional recombinant nuoA present several challenges with corresponding methodological solutions:

Challenges:

• Membrane protein solubility: As a transmembrane protein, nuoA tends to aggregate when expressed recombinantly due to its hydrophobic nature .

• Maintaining native conformation: Ensuring the recombinant protein adopts its proper folding to study functional aspects .

• Low expression yields: Membrane proteins often express at lower levels than soluble proteins .

• Toxicity to expression hosts: Overexpression of membrane proteins can disrupt host cell membranes .

• Stability during purification: Maintaining protein stability during extraction from membranes and subsequent purification steps .

Methodological Solutions:

• Optimized expression systems: E. coli has been successfully used for nuoA expression with specific strain selection (e.g., C41(DE3) or C43(DE3)) designed for membrane protein expression .

• Fusion tags strategy: N-terminal His-tags have been successfully employed to facilitate purification while maintaining protein function. The commercially available recombinant proteins use this approach .

• Detergent screening: Systematic testing of different detergents for membrane extraction and protein stabilization during purification .

• Buffer optimization: Including stabilizing agents such as glycerol (5-50%) in storage buffers improves long-term stability, as recommended for commercial recombinant nuoA .

• Lyophilization approach: Commercial preparations are available as lyophilized powder, which enhances stability during storage .

• Reconstitution protocols: Carefully designed reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol for long-term storage at -20°C/-80°C .

These approaches have successfully produced recombinant nuoA protein with greater than 90% purity as determined by SDS-PAGE, suitable for various research applications .

How can genetic manipulation techniques be applied to study nuoA function in Ralstonia solanacearum?

Several genetic manipulation techniques can be effectively applied to study nuoA function in R. solanacearum:

• Natural transformation: Many R. solanacearum strains possess natural competence, allowing them to internalize exogenous DNA. This property can be exploited to introduce nuoA mutations or reporter constructs by preparing competent cells and exposing them to purified DNA containing the desired modifications flanked by homologous sequences .

• Electrotransformation: For strains lacking natural competence or for more efficient transformation, electroporation can be used to create transient pores in the bacterial membrane. This technique has been standardized for R. solanacearum with specific parameters for optimal transformation efficiency .

• Bacterial conjugation: A three-partner mating approach using E. coli donor strains carrying nuoA constructs, helper strains providing transfer functions, and R. solanacearum recipient strains enables the transfer of large plasmids or for strains recalcitrant to other transformation methods .

• Transposon mutagenesis and Tn-seq: Random transposon libraries can be created and screened in planta to assess the role of nuoA in virulence. The Tn-seq approach has successfully identified respiratory chain components required for plant colonization .

• Site-directed mutagenesis: Precise alterations to specific amino acids within nuoA can be introduced to study structure-function relationships. Key residues can be identified from alignment with homologous proteins from other species .

• Reporter gene fusions: Transcriptional or translational fusions of nuoA with reporter genes like GFP or luciferase allow monitoring of expression patterns during infection .

These methods have been successfully applied in reverse genetics studies to create mutants and reporter gene constructs for investigating the molecular basis of pathogenesis in R. solanacearum .

What analytical techniques are most effective for characterizing the biochemical properties of recombinant nuoA?

Multiple analytical techniques can effectively characterize the biochemical properties of recombinant nuoA:

• Circular Dichroism (CD) Spectroscopy: Essential for assessing secondary structure composition and folding of the recombinant protein, particularly important for membrane proteins like nuoA to confirm proper folding after purification .

• Size Exclusion Chromatography (SEC): Evaluates the oligomeric state and homogeneity of the purified protein, helping to distinguish between monomeric nuoA and potential aggregates .

• Surface Plasmon Resonance (SPR): Measures binding kinetics between nuoA and potential interaction partners, including other respiratory chain components or inhibitors .

• Isothermal Titration Calorimetry (ITC): Quantifies thermodynamic parameters of nuoA interactions with ligands, providing insights into binding mechanisms .

• Mass Spectrometry (MS): Confirms protein identity, evaluates post-translational modifications, and can be used in hydrogen-deuterium exchange experiments to probe structural dynamics .

• Electron Paramagnetic Resonance (EPR): Particularly useful for studying electron transfer through the respiratory chain, including the contribution of nuoA .

• Reconstitution in Proteoliposomes: Incorporation of purified nuoA into artificial membrane systems allows functional assays in a controlled environment .

• Enzyme Activity Assays: Measurement of NADH:quinone oxidoreductase activity in reconstituted systems containing nuoA and other complex components .

For membrane proteins like nuoA, detergent selection is critical. Comparing activity and structural parameters in different detergents (e.g., DDM, LMNG, or amphipols) can identify conditions that best preserve native function. These techniques have been successfully applied to characterize respiratory chain components from various bacterial species and can be adapted specifically for R. solanacearum nuoA .

How can researchers address the challenges of data contradictions when studying nuoA in different experimental systems?

Researchers can systematically address data contradictions when studying nuoA using several methodological approaches:

• Standardized contradiction notation: Implement a formal system for representing contradictions, similar to what has been proposed for biomedical data. This would involve parameters (α, β, θ) representing the number of interdependent items, contradictory dependencies, and minimal Boolean rules needed to assess these contradictions .

• Multi-system validation protocol: Develop a structured validation pipeline that tests nuoA function across different experimental systems:

  • In vitro biochemical assays

  • Bacterial culture systems

  • Plant infection models

  • Heterologous expression systems

• Contradiction resolution workflow:
  a. Identify specific contradictory observations
  b. Systematically vary experimental conditions to identify context-dependent factors
  c. Develop mathematical models to account for observed variations
  d. Test predictions in new experimental contexts

• Context-dependent analysis framework: Consider how different experimental backgrounds might affect nuoA function:

• Data integration strategies: Implement statistical approaches that can integrate seemingly contradictory data to identify underlying patterns, such as Bayesian networks or machine learning methods that account for context-dependent variables .

• Collaborative validation: Establish inter-laboratory validation protocols where multiple research groups test the same hypotheses about nuoA using their established systems to identify reproducible findings versus context-specific results .

This structured approach to contradiction management ensures that apparent conflicts in data become opportunities to discover context-dependent factors affecting nuoA function rather than simply discrepancies to be resolved .

What are the most effective approaches for studying interactions between nuoA and other components of the respiratory chain?

Several complementary approaches can effectively investigate interactions between nuoA and other respiratory chain components:

• Co-immunoprecipitation (Co-IP) with epitope-tagged proteins: Using recombinant His-tagged nuoA as bait to pull down interacting partners from R. solanacearum lysates, followed by mass spectrometry identification of bound proteins. This approach can identify both stable and transient interactions within the respiratory complex .

• Bacterial two-hybrid (B2H) system: Expressing fusion proteins of nuoA and potential interaction partners (e.g., nuoB, nuoK) linked to complementary fragments of adenylate cyclase in E. coli. Protein interaction reconstitutes cyclase activity, activating reporter genes .

• Chemical cross-linking coupled with mass spectrometry (XL-MS): Using bifunctional cross-linking agents to covalently link nuoA to neighboring proteins in intact complexes, followed by digestion and mass spectrometry to identify cross-linked peptides. This approach provides spatial information about protein arrangements within the complex .

• Fluorescence resonance energy transfer (FRET): Creating fusion proteins of nuoA and potential partners with appropriate fluorophores to detect proximity-dependent energy transfer in living cells .

• Cryo-electron microscopy: Applied to purified respiratory complexes containing nuoA to determine structural arrangements at near-atomic resolution, revealing the architectural context of nuoA within the complex .

• Surface plasmon resonance (SPR): Using purified recombinant nuoA immobilized on a sensor chip to quantify binding kinetics with other purified respiratory chain components .

• Genetic suppressor screens: Identifying mutations in other genes that suppress defects caused by nuoA mutations, revealing functional interactions .

• Comparative genomics approach: Analyzing co-evolution patterns of nuoA with other respiratory chain components across the R. solanacearum species complex to identify strongly co-evolving partners .

These methods have been successfully applied to study respiratory chain component interactions in various bacterial systems and can be adapted for R. solanacearum to understand the specific role of nuoA within the larger complex .

What strategies can be employed to investigate the role of nuoA in Ralstonia solanacearum virulence and host plant interactions?

Multiple complementary strategies can effectively investigate nuoA's role in virulence and host interactions:

• Targeted gene deletion and complementation: Creating nuoA knockout mutants and complemented strains to assess the impact on virulence in different plant hosts. This approach can definitively establish whether nuoA is essential for pathogenicity .

• Conditional expression systems: Developing strains with inducible nuoA expression to study the consequences of altered nuoA levels during different infection stages .

• In planta transcriptomics: Comparing gene expression profiles between plants infected with wild-type and nuoA mutant bacteria to identify host response differences. This reveals how respiratory chain function impacts host-pathogen interactions .

• Host range assessment: Testing nuoA mutants on different plant species to determine if respiratory chain function differentially affects virulence across hosts. This is particularly relevant given R. solanacearum's broad host range (>250 plant species) .

• Environmental condition screening: Evaluating how nuoA contribution to virulence varies under different temperature, pH, and nutrient conditions that mimic various plant environments .

• Competitive index assays: Co-inoculating plants with wild-type and nuoA mutant strains to quantify relative fitness during infection. This approach has successfully identified genes required for in planta survival .

• Microscopy visualization: Using fluorescently labeled bacteria to track colonization patterns of wild-type versus nuoA mutants in plant tissues .

• Metabolic profiling: Comparing metabolites produced by wild-type and nuoA mutants during infection to understand how energy metabolism contributes to the infection process .