Recombinant Ralstonia solanacearum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; RSc2052; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
nuoK
Target Protein Sequence
MLSLAHYLVLGAVLFAISIVGIFLNRKNVIVLLMAIELMLLAVNMNFVAFSHYLGDLAGQ VFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDLDSLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation, transferring four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy within a proton gradient.
Database Links

KEGG: rso:RSc2052

STRING: 267608.RSc2052

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Ralstonia solanacearum NADH-quinone oxidoreductase subunit K (nuoK)?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the respiratory chain complex I in Ralstonia solanacearum. It functions as part of the NADH dehydrogenase I complex (NDH-1) that catalyzes electron transfer from NADH to quinones in the bacterial inner membrane, contributing to energy generation through the respiratory chain. The protein is encoded by the nuoK gene (locus RSc2052 in the GMI1000 strain) and consists of 101 amino acids in its full-length form . The protein has a highly hydrophobic character, containing multiple transmembrane domains that anchor it within the bacterial membrane.

What are the structural characteristics of nuoK protein?

The nuoK protein is a small, hydrophobic membrane protein with several key structural features:

FeatureCharacteristicDetails
Length101 amino acidsFull-length protein (1-101aa)
SequenceMLSLAHYLVLGAVLFAISIVGIFLNRKNVIVLLMAIELMLLAVNMNFVAFSHYLGDLAGQVFVFFILTVAAAESAIGLAILVVLFRNLDTINVDDLDSLKGContains multiple hydrophobic regions
UniProt IDQ8XXR1Reference identifier for the protein
StructureMembrane-integratedMultiple transmembrane helices predicted based on sequence
FunctionElectron transportComponent of respiratory complex I

The highly hydrophobic nature of this protein, as evidenced by the abundance of hydrophobic amino acids (leucine, isoleucine, valine, etc.) in its sequence, suggests multiple membrane-spanning domains that are critical for its integration into the bacterial membrane and function within the respiratory complex.

How does nuoK contribute to bacterial metabolism?

The nuoK subunit plays a critical role in the energy metabolism of Ralstonia solanacearum by participating in the electron transport chain. As part of the NADH-quinone oxidoreductase complex (Complex I), it helps catalyze the transfer of electrons from NADH to quinones, coupled with proton translocation across the membrane. This process contributes to the generation of the proton motive force that drives ATP synthesis, providing the bacterium with the energy needed for various cellular processes, including pathogenesis and survival within host plants . The protein's membrane localization is essential for maintaining the structural integrity of the respiratory complex and facilitating efficient electron transfer.

What expression systems are optimal for producing recombinant nuoK?

Based on available research data, E. coli has been successfully employed as an expression system for recombinant nuoK protein production:

Expression SystemTagAdvantagesConsiderations
E. coliHis-tag (N-terminal) - Well-established protocols
- High protein yield
- Simplified purification
- Potential folding issues with membrane proteins
- May require optimization of growth conditions
- Possible toxicity of membrane protein overexpression
Alternative systemsVarious tags possible- Improved folding for membrane proteins
- Post-translational modifications
- Reduced toxicity
- Lower yields
- Higher cost
- More complex protocols

When expressing membrane proteins like nuoK, researchers should consider using specialized E. coli strains designed for membrane protein expression or alternative systems such as yeast or insect cells if functional studies requiring proper folding are planned. The selection of an N-terminal His-tag has proven effective for purification while minimizing interference with protein function .

What are the recommended storage and handling conditions for recombinant nuoK?

Proper storage and handling of recombinant nuoK is critical for maintaining protein stability and activity:

ConditionRecommendationRationale
Short-term storage4°C for up to one week Minimizes protein degradation while allowing immediate access
Long-term storage-20°C/-80°C with aliquoting Prevents protein degradation over extended periods
Storage bufferTris-based buffer with 50% glycerol or Tris/PBS-based buffer with 6% Trehalose, pH 8.0 Stabilizes protein structure and prevents aggregation
Freeze-thaw cyclesAvoid repeated freezing and thawing Prevents protein denaturation and loss of activity
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol Optimizes protein stability while maintaining solubility

It is advisable to centrifuge vials briefly before opening to ensure all material is at the bottom of the tube. When working with membrane proteins like nuoK, additional considerations may include the addition of mild detergents to maintain solubility or reconstitution into lipid vesicles for functional studies .

What purification strategies are most effective for recombinant nuoK?

For His-tagged recombinant nuoK, the following purification strategy has proven effective:

  • Immobilized Metal Affinity Chromatography (IMAC): Using Ni-NTA or similar matrices to capture the His-tagged protein directly from cell lysates.

  • Detergent selection: Careful selection of detergents (such as DDM, LDAO, or Fos-choline) is critical for membrane protein solubilization while maintaining structural integrity.

  • Size Exclusion Chromatography (SEC): As a polishing step to remove aggregates and ensure homogeneity.

The target purity level should exceed 90% as determined by SDS-PAGE analysis , which is suitable for most research applications including structural studies and functional assays.

How might nuoK function relate to Ralstonia solanacearum pathogenicity?

Ralstonia solanacearum is a widespread bacterial plant pathogen causing bacterial wilt in numerous plant species, including economically important crops . The connection between nuoK function and pathogenicity may involve several aspects:

Research into the role of respiratory chain components in bacterial pathogens suggests that disruption of energy metabolism can significantly impact virulence. The nuoK subunit, as part of the respiratory complex I, may therefore represent a potential target for controlling R. solanacearum infections in agricultural settings .

What analytical techniques are most informative for studying nuoK structure-function relationships?

Several advanced techniques can provide valuable insights into nuoK structure-function relationships:

TechniqueApplicationInformation Obtained
Cryo-electron microscopyStructural analysisHigh-resolution structural data of nuoK within the respiratory complex
Site-directed mutagenesisFunctional analysisIdentification of critical residues for function and interactions
Isothermal titration calorimetryBinding studiesThermodynamic parameters of nuoK interactions with other complex components
Blue native PAGEComplex assemblyAssessment of nuoK incorporation into the respiratory complex
Membrane potential assaysFunctional analysisEvaluation of respiratory complex activity with modified nuoK variants
Molecular dynamics simulationsTheoretical analysisInsights into dynamic aspects of nuoK within the membrane environment

Combining these approaches in a comprehensive research program can provide a detailed understanding of how nuoK structure relates to its function within the respiratory complex and potentially its role in bacterial pathogenicity.

How can comparative genomic analyses of nuoK inform evolutionary studies of Ralstonia solanacearum?

Comparative genomic analyses of nuoK sequences across Ralstonia solanacearum strains can provide valuable insights into bacterial evolution and adaptation:

Analysis ApproachResearch QuestionPotential Outcome
Phylogenetic analysisHow has nuoK evolved across R. solanacearum phylotypes?Identification of selection pressures on respiratory components
Sequence conservationWhich regions of nuoK are most conserved?Determination of functionally critical domains
Strain comparisonDo nuoK sequences differ between strains with varying host ranges?Correlation between nuoK variants and host specificity
Horizontal gene transferHas nuoK been subject to horizontal transfer events?Understanding the evolution of respiratory complexes in plant pathogens

Ralstonia solanacearum is described as a highly flexible organism capable of rapid adaptation to environmental changes and new hosts . Studying the evolution of essential metabolic components like nuoK can provide insights into how this pathogen has adapted to diverse ecological niches and host plants.

What are common challenges when working with recombinant nuoK and how can they be addressed?

Researchers working with recombinant nuoK may encounter several challenges due to its nature as a membrane protein:

ChallengeCauseSolution
Low expression levelsToxicity to host cellsUse tightly controlled inducible expression systems; lower induction temperature
Protein aggregationImproper folding in expression hostOptimize detergent selection; consider fusion partners to enhance solubility
Loss of activity during purificationHarsh purification conditionsUse milder detergents; maintain cold temperatures throughout purification
Inconsistent reconstitutionVariable lipid incorporationStandardize lipid composition and protein-to-lipid ratios; validate incorporation
Poor antibody recognitionConformational epitopes disruptedUse multiple detection antibodies targeting different regions; consider native PAGE
Degradation during storageProtease contaminationAdd protease inhibitors; ensure high purity before storage

When troubleshooting expression and purification issues, it's advisable to analyze samples at each step of the procedure using techniques such as Western blotting, ELISA, or activity assays to identify at which point problems are occurring.

How can researchers validate the functional integrity of purified recombinant nuoK?

Validating the functional integrity of recombinant nuoK is essential before using it in downstream applications:

Validation MethodPrincipleInterpretation
NADH oxidation assayMeasures electron transfer from NADH to artificial electron acceptorsActive protein should catalyze NADH oxidation when incorporated into proteoliposomes
Proton pumping assayMeasures pH changes across membranes containing reconstituted proteinFunctional nuoK will contribute to proton translocation when part of the complex
Binding assaysAssesses interaction with known complex I componentsProperly folded nuoK should maintain its ability to interact with partner proteins
Circular dichroism (CD)Evaluates secondary structure contentSpectrum should be consistent with membrane protein with predicted α-helical content
Thermal shift assayDetermines protein stabilityStable, properly folded protein will show cooperative unfolding

It's important to note that as nuoK functions as part of a multi-subunit complex, some functional assays may require co-expression or reconstitution with other complex I components to obtain meaningful results.

How should researchers approach contradictory results in nuoK studies?

When faced with contradictory results in nuoK research, a systematic approach is recommended:

  • Experimental design reassessment:

    • Evaluate if differences in experimental conditions could explain contradictory results

    • Consider variables such as expression systems, tags, purification methods, and assay conditions

  • Technical validation:

    • Verify protein identity by mass spectrometry

    • Confirm purity by multiple methods (SDS-PAGE, SEC-MALS)

    • Assess protein state (monomer vs. oligomer, native vs. denatured)

  • Biological context:

    • Consider strain-specific differences in nuoK sequence or function

    • Evaluate the impact of the experimental system on protein behavior

    • Assess whether in vitro conditions adequately represent the in vivo environment

  • Collaborative verification:

    • Engage with other laboratories to independently reproduce critical experiments

    • Consider using complementary methodologies to address the same question

  • Computational analysis:

    • Use molecular modeling to predict the impact of experimental conditions

    • Perform literature meta-analysis to identify patterns in contradictory results

Contradictory results often reveal important nuances in protein behavior that can lead to deeper understanding of nuoK function in different contexts.

What emerging technologies show promise for advancing nuoK research?

Several cutting-edge technologies hold significant potential for advancing our understanding of nuoK:

TechnologyApplication to nuoK ResearchPotential Impact
Cryo-EMHigh-resolution structural determination of nuoK within the respiratory complexDetailed understanding of molecular interactions and mechanism
Single-molecule techniquesDynamics of nuoK within the membrane environmentInsights into conformational changes during function
CRISPR-Cas9 genome editingPrecise manipulation of nuoK in native Ralstonia solanacearumDirect correlation between nuoK variants and bacterial phenotypes
Hydrogen-deuterium exchange MSMapping dynamic protein-protein interactionsUnderstanding nuoK's role in complex assembly and function
Computational protein designEngineering improved or altered nuoK functionsDevelopment of tools for studying respiratory chain function
Nanodiscs technologyStable incorporation of nuoK into defined membrane environmentsImproved functional studies in near-native conditions

These technologies could help resolve current knowledge gaps regarding how nuoK contributes to respiratory complex function and potentially to bacterial pathogenicity.

How might nuoK research contribute to understanding and controlling Ralstonia solanacearum infections?

Research on nuoK may provide valuable insights for agricultural applications:

Research AreaPotential ContributionAgricultural Impact
Energy metabolism inhibitorsIdentification of compounds that specifically target bacterial respiratory complexesNovel bactericides with specific activity against plant pathogens
Virulence-metabolism connectionsUnderstanding how energy production relates to virulence factor expressionStrategies to attenuate bacterial pathogenicity
Host-pathogen interactionsInsights into bacterial adaptation to host environmentsDevelopment of plant varieties with enhanced resistance
Bacterial physiologyUnderstanding of persistence mechanisms under stress conditionsImproved management strategies for infected fields
Diagnostic developmentIdentification of specific markers related to respiratory functionEarly detection methods for Ralstonia infections

As Ralstonia solanacearum is a soil-borne bacterium causing widespread disease in economically important crops , advances in understanding its basic biology through nuoK research could contribute significantly to developing sustainable control strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.