Recombinant Ralstonia solanacearum Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kdpC; RSc3384; RS02658; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
kdpC
Target Protein Sequence
MATTTQPAHAEAPQQGGLLRAALVIFVGLSLVTGVLYPVVVTGIGKAAFPAQAGGSIIER GGKPVGSALIGQNFSEPQYFWGRLSATSPNPYNGAASSGSNLGPSNPALTDAAKARIAAL KEADPANTAPIPVDLVTASASGLDPHISPAAAAYQVERVARARHLPVERVKTLVAEHTTA PILGVFGEPVVNVLELNLGLGDLK
Uniprot No.

Target Background

Function

Recombinant Ralstonia solanacearum Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links

KEGG: rso:RSc3384

STRING: 267608.RSc3384

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function and structural organization of kdpC in Ralstonia solanacearum?

The kdpC gene encodes the transmembrane C subunit of the Kdp-ATPase system in Ralstonia solanacearum, a Gram-negative bacterium notorious for causing bacterial wilt in solanaceous plants. This protein forms part of a high-affinity potassium (K+) transporter essential for bacterial survival under low-K+ environments, enabling osmoregulation and maintaining membrane potential.

From a structural perspective, kdpC contains two transmembrane helices and a conserved "K+ channel" motif (P-loop) critical for selective ion transport. While detailed structural data specifically for R. solanacearum kdpC remains limited, homologous systems (e.g., Escherichia coli KdpC) suggest a tetrameric arrangement of kdpC subunits forming a selective pore.

The Kdp-ATPase complex consists of three main subunits working together:

SubunitFunctionStructural Features
kdpAMembrane-bound subunit for K+ translocationMultiple transmembrane domains
kdpBATP-binding subunit (ATPase)Couples ATP hydrolysis to K+ transport
kdpCTransmembrane channel for ion conductionTwo transmembrane helices, P-loop motif

For experimental investigation of kdpC function, researchers typically employ gene deletion approaches followed by phenotypic analysis under potassium-limited conditions, along with complementation studies to confirm that observed phenotypes are directly attributable to kdpC function rather than polar effects.

What methods are most effective for genetically manipulating kdpC in Ralstonia solanacearum?

When manipulating kdpC in R. solanacearum, natural transformation using PCR products has proven to be significantly more efficient than traditional methods like triparental mating and electroporation . This approach exploits the natural competence of R. solanacearum and the FLP/FRT recombination system.

The recommended protocol involves:

  • Generating fusion PCR fragments containing:

    • Upstream homologous region of kdpC

    • An antibiotic resistance gene (e.g., gentamicin resistance) flanked by FRT sites

    • Downstream homologous region of kdpC

  • Delivering these PCR products directly into bacterial cells via natural transformation, which yields transformation frequencies significantly higher than other methods .

  • Selecting transformants on antibiotic-containing media and verifying gene deletion via PCR analysis.

  • Optionally removing the antibiotic marker using FLP recombinase expressed from a plasmid (pFLPkm) for marker-free deletions.

MethodRelative Transformation EfficiencyAdvantagesLimitations
Natural TransformationHighest (significantly better than others)Simpler protocol, higher efficiencyRequires competent cells
ElectroporationModerateWorks for various strainsLower efficiency, cell damage
Triparental MatingLowestWorks for non-competent strainsMost time-consuming, lowest efficiency

This methodology has been successfully applied across multiple R. solanacearum strains isolated from different host plants (including tomato, potato, tobacco, and zucchini), demonstrating its broad applicability for functional genomic studies of genes like kdpC .

How does the KdpDE two-component system regulate kdpC expression?

The KdpDE two-component system plays a crucial role in regulating kdpC expression as part of the potassium homeostasis network. This regulatory system consists of:

  • KdpD: A membrane-anchored histidine kinase with multiple domains including an N-terminal sensory cytoplasmic region (NTR) containing KdpD' and universal stress protein (USP) domains, a transmembrane domain, and a cytoplasmic C-terminal region with a transmitter GAF domain and EnvZ-like catalytic HK domain .

  • KdpE: A response regulator that, when phosphorylated by KdpD, binds to specific promoter regions to regulate the transcription of the kdpFABC operon which includes kdpC.

The regulation process operates through environmental sensing:

  • KdpD senses environmental signals, particularly low potassium conditions

  • Upon signal detection, KdpD undergoes autophosphorylation

  • The phosphoryl group is transferred to KdpE

  • Phosphorylated KdpE binds to the promoter region of the kdpFABC operon

  • This binding activates transcription of kdpC and other operon components

For studying this regulatory system, researchers typically employ:

  • Phosphorylation assays to measure KdpD-KdpE phosphotransfer

  • DNA binding assays to analyze KdpE interaction with the promoter

  • Reporter gene assays to quantify promoter activity under various conditions

  • Site-directed mutagenesis to identify key residues involved in signaling

The KdpDE system is widespread in bacteria and archaea, controlling potassium homeostasis and virulence by regulating multiple genes, particularly the kdpFABC operon .

What is the relationship between c-di-AMP signaling and the Kdp-ATPase system?

Cyclic-di-adenosine monophosphate (c-di-AMP) is a bacterial second messenger that plays a significant role in modulating the KdpDE two-component system, which directly affects kdpC expression and function. While specific details for Ralstonia solanacearum are still being elucidated, structural and biochemical studies with related bacterial systems provide valuable insights.

Research has demonstrated that c-di-AMP interacts with the Universal Stress Protein (USP) domain in the N-terminal region (NTR) of KdpD histidine kinase . This interaction modulates KdpD activity, thereby influencing the phosphorylation state of KdpE and subsequently affecting kdpC expression.

Structural studies have revealed that the USP domain of KdpD (USPSa) complexed with c-di-AMP displays distinctive features compared to canonical standalone USPs that typically bind ATP. These features include:

  • Inward-facing conformations of β1-α1 and β4-α4 loops

  • A short α2 helix

  • Absence of a triphosphate-binding Walker A motif

  • A unique dual phospho-ligand binding mode

Binding affinity analysis of USPSa mutants has identified a specific binding motif: (A/G/C)XSXSX2N(Y/F), which allows prediction of c-di-AMP binding in other KdpD histidine kinases .

This regulatory pathway is particularly significant as c-di-AMP signaling is associated with antibiotic resistance, K+ homeostasis, DNA damage repair, virulence, and sporulation in various bacteria .

How can recombinant kdpC protein be effectively produced and purified?

Production of recombinant Ralstonia solanacearum kdpC protein presents specific challenges due to its transmembrane nature. The following methodological approach has proven successful:

Expression System Selection:

For membrane proteins like kdpC, specialized E. coli strains such as C41/C43(DE3) designed for membrane protein expression often yield better results than standard BL21(DE3).

Construct Design:

  • Clone the kdpC gene (partial or full-length) into an expression vector with an N-terminal His6-tag

  • Include a protease cleavage site (TEV or PreScission) for tag removal

  • Consider fusion partners (MBP, SUMO) to enhance solubility

Optimized Expression Protocol:

  • Transform into the selected E. coli strain

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce with low concentrations of IPTG (0.1-0.5 mM)

  • Shift to 18-20°C for overnight expression

  • Include membrane protein-specific additives (glycerol, specific detergents)

Membrane Protein Extraction:

  • Harvest cells and disrupt by sonication or French press

  • Isolate membranes by ultracentrifugation (100,000 × g for 1 hour)

  • Solubilize membranes with appropriate detergents (n-Dodecyl β-D-maltoside or LMNG)

Purification Strategy:

  • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA resin

  • Size exclusion chromatography to remove aggregates

  • Quality control via SDS-PAGE to verify purity (target >85%)

For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to maintain native conformation and activity of the transmembrane kdpC protein.

How does kdpC contribute to the pathogenicity of Ralstonia solanacearum?

The kdpC subunit contributes to R. solanacearum pathogenicity through several interconnected mechanisms:

Potassium Homeostasis during Infection:

As part of the high-affinity K+ transport system, kdpC enables bacterial survival in potassium-limited plant environments, particularly during early infection stages when nutrients may be scarce. This potassium uptake capability is critical for maintaining cell turgor, osmoregulation, and proper enzyme function.

Osmoregulation:

R. solanacearum encounters varying osmotic conditions during plant colonization. The kdpC-containing Kdp-ATPase system helps the bacterium adapt to these changes by maintaining appropriate intracellular K+ concentrations, which is essential for colonization of xylem vessels.

Virulence Regulation:

The KdpDE two-component system, which regulates kdpC expression, has been linked to virulence gene expression in multiple bacterial species. In R. solanacearum, this system may interact with other virulence regulators, such as PhcA, which controls multiple virulence factors including exopolysaccharide (EPS) production .

Experimental approaches to investigate kdpC's role in pathogenicity include:

  • Gene deletion studies using the efficient natural transformation method with the FLP/FRT system described earlier

  • Plant infection assays comparing wild-type and kdpC mutant strains

  • Transcriptome analysis to identify virulence genes co-regulated with kdpC

  • In planta expression studies using fluorescent reporters

What are the current challenges and future directions in kdpC research?

Research on R. solanacearum kdpC faces several key challenges and promising future directions:

Current Technical Challenges:

  • Structural Characterization: Limited high-resolution structural data specifically for R. solanacearum kdpC hampers understanding of its unique features. While homologous systems provide insights, species-specific details remain elusive .

  • Genomic Heterogeneity: The R. solanacearum species complex shows significant genome heterogeneity across strains isolated from different host plants, complicating genetic manipulation and comparative studies .

  • Membrane Protein Difficulties: The transmembrane nature of kdpC creates technical challenges for expression, purification, and functional studies, requiring specialized approaches.

Emerging Research Directions:

Research AreaApproachPotential Impact
Structural BiologyCryo-EM studies of the complete Kdp-ATPase complexDetailed mechanistic understanding of potassium transport
Inhibitor DevelopmentStructure-based design targeting the unique features of kdpCNovel antimicrobial strategies against R. solanacearum
Systems BiologyIntegration of kdpC function with global virulence networksComprehensive understanding of pathogenicity mechanisms
Host-Pathogen InteractionInvestigating how plant K+ status affects kdpC expressionPotential for breeding resistant crop varieties
Comparative GenomicsAnalysis of kdpC across the R. solanacearum species complexEvolution of virulence mechanisms

Methodological Advances:

Recent developments in markerless gene deletion techniques exploiting natural transformation competence and the FLP/FRT recombination system have significantly improved genetic manipulation capabilities in R. solanacearum . These advances enable more efficient functional studies of kdpC and other genes.

Future research will likely focus on integrating structural insights with functional genomics to develop comprehensive models of potassium homeostasis in this important plant pathogen, potentially leading to new strategies for controlling bacterial wilt in economically important crops.

How do different experimental conditions affect kdpC expression and function?

The expression and function of kdpC in Ralstonia solanacearum are highly influenced by experimental conditions, which must be carefully controlled when studying this protein:

Potassium Concentration:

The most critical parameter affecting kdpC expression is extracellular potassium concentration. Expression is typically induced under low-K+ conditions (<0.2 mM) and repressed when potassium is abundant (>1 mM). Researchers must ensure precise control of K+ levels in growth media, as even trace contaminants can affect results.

Growth Media Composition:

Studies have shown that the choice of growth media significantly affects transformation efficiency in R. solanacearum, which is relevant when manipulating the kdpC gene. Comparing Luria-Bertani (LB), Cell-To-Cell signaling (CTG), and Minimal Media with Glucose (MMG), transformation efficiencies vary substantially, with CTG and MMG media showing superior results .

DNA Concentration for Transformation:

When performing genetic manipulations of kdpC, DNA concentration significantly impacts transformation efficiency. Experimental data demonstrate a direct correlation between DNA concentration and transformation frequency up to a certain threshold .

Host Plant Variation:

For functional studies examining kdpC's role in pathogenicity, the choice of host plant can significantly impact results. R. solanacearum strains from different host plants show varied natural transformation competence, affecting the efficiency of genetic manipulation . Experimental designs should account for these strain-specific variations.

Temperature and pH:

Both temperature and pH affect kdpC expression and protein stability. While standard culturing of R. solanacearum occurs at 28°C, lower temperatures (18-20°C) are often optimal for recombinant protein expression to prevent aggregation of membrane proteins like kdpC.

These considerations are essential for designing robust experiments that yield reproducible results when studying kdpC in R. solanacearum.

What methodologies are available for studying kdpC-mediated ion transport?

Investigating the ion transport function of kdpC requires specialized methodologies appropriate for membrane transport proteins:

Proteoliposome-Based Transport Assays:

  • Reconstitution Procedure:

    • Purify recombinant kdpC along with kdpA and kdpB subunits

    • Incorporate the purified complex into liposomes composed of E. coli lipids

    • Remove detergent using Bio-Beads or dialysis

    • Verify proper incorporation by freeze-fracture electron microscopy

  • Radioactive Flux Measurements:

    • Load proteoliposomes with non-radioactive buffer

    • Initiate transport by adding radioactive 42K+ and ATP

    • Terminate reaction at defined time points by filtration

    • Quantify radioactivity using liquid scintillation counting

  • Fluorescence-Based Assays:

    • Incorporate potential-sensitive fluorescent dyes (DiSC3(5)) into proteoliposomes

    • Monitor membrane potential changes during K+ transport

    • Calibrate using ionophores (valinomycin) as controls

Electrophysiological Approaches:

  • Planar Lipid Bilayer Recordings:

    • Form planar lipid bilayers across apertures in Teflon partitions

    • Incorporate purified kdpC or Kdp-ATPase complex

    • Record single-channel currents using patch-clamp amplifiers

    • Analyze conductance, open probability, and ion selectivity

  • Patch-Clamp of Giant Liposomes:

    • Create giant unilamellar vesicles (GUVs) containing reconstituted kdpC

    • Apply patch-clamp techniques to measure ion currents

    • Test effects of inhibitors and mutations on channel properties

Cell-Based Functional Assays:

  • Complementation Studies:

    • Create E. coli strains lacking endogenous K+ uptake systems

    • Express R. solanacearum kdpC and associated subunits

    • Assess growth restoration under K+-limiting conditions

    • Compare wild-type kdpC with mutant variants

  • Intracellular K+ Measurement:

    • Use K+-selective fluorescent indicators (PBFI) to measure intracellular K+ levels

    • Monitor real-time changes in K+ concentration upon environmental shifts

    • Compare wild-type and kdpC mutant strains

These methodologies provide complementary approaches to characterize the ion transport function of kdpC, from purified protein studies to cellular contexts, enabling comprehensive understanding of its role in potassium homeostasis.

How can comparative genomics inform our understanding of kdpC evolution in Ralstonia solanacearum?

Comparative genomics approaches offer powerful insights into the evolution and functional adaptation of kdpC across the Ralstonia solanacearum species complex (RSSC):

Phylogenetic Analysis Framework:

  • Sequence Collection and Alignment:

    • Gather kdpC sequences from diverse RSSC strains representing different phylotypes and host plants

    • Include outgroups from related species (e.g., R. pickettii, R. insidiosa)

    • Create multiple sequence alignments using algorithms optimized for transmembrane proteins

  • Evolutionary Rate Analysis:

    • Calculate selective pressure (dN/dS ratios) across the gene

    • Identify regions under positive, neutral, or purifying selection

    • Map selection patterns to functional domains (transmembrane regions, K+ selectivity filter)

  • Coevolution Analysis:

    • Analyze coevolution between kdpC and other components of the Kdp-ATPase system

    • Identify coordinated evolutionary changes in interacting residues

    • Infer functional constraints on protein-protein interactions

Genomic Context Analysis:

  • Operon Structure Comparison:

    • Examine conservation of the kdpFABC operon across RSSC strains

    • Identify instances of gene rearrangements or insertions

    • Correlate operon structure with ecotypes and host adaptation

  • Regulatory Region Analysis:

    • Compare promoter regions and KdpE binding sites

    • Identify cis-regulatory differences that might affect expression

    • Correlate regulatory differences with ecological niches

Horizontal Gene Transfer (HGT) Detection:

  • Anomalous Sequence Composition:

    • Analyze GC content, codon usage bias, and tetranucleotide frequencies

    • Identify signatures of potential HGT events involving kdpC

  • Reconciliation of Gene and Species Trees:

    • Construct kdpC gene trees and compare with species phylogeny

    • Identify discordance indicative of HGT

    • Estimate timing and frequency of transfer events

These approaches can reveal how kdpC has evolved in response to different selection pressures, such as host plant range, geographical distribution, and potassium availability in different environments. The results can inform functional studies by identifying naturally occurring variants with potentially altered functions and providing evolutionary context for experimental observations.

What approaches can be used to develop inhibitors targeting kdpC for agricultural applications?

Developing inhibitors targeting kdpC represents a promising approach for controlling Ralstonia solanacearum infections in crops. A comprehensive drug discovery pipeline would include:

Target Validation Strategies:

  • Genetic Validation:

    • Confirm that kdpC deletion significantly reduces virulence in planta

    • Establish whether chemical inhibition can phenocopy genetic knockout

    • Determine if resistance to kdpC inhibition can develop rapidly

  • Target Essentiality Assessment:

    • Determine conditions under which kdpC becomes essential (e.g., low K+ environments)

    • Evaluate whether bypass mechanisms exist that could circumvent inhibition

    • Assess potential effects on beneficial soil microorganisms

Structure-Based Drug Design:

  • Binding Site Identification:

    • Focus on the transmembrane channel and K+ selectivity filter

    • Analyze interfaces between kdpC and other Kdp-ATPase subunits

    • Use computational solvent mapping to identify druggable pockets

  • Virtual Screening Workflow:

    • Prepare homology model based on related potassium channel structures

    • Perform molecular docking of compound libraries

    • Apply pharmacophore filtering based on key interaction features

    • Conduct molecular dynamics simulations to assess binding stability

Experimental Screening Methods:

ApproachMethodologyAdvantagesConsiderations
Biochemical AssaysATPase activity measurement with purified Kdp complexDirect assessment of inhibitionRequires purified protein
Bacterial Growth AssaysGrowth inhibition under K+-limited conditionsWhole-cell activity evaluationMay identify non-specific inhibitors
Plant Protection AssaysAssessment of disease reduction in plantaDirectly tests agricultural relevanceTime-consuming, variable
Biophysical ScreeningSurface plasmon resonance, thermal shift assaysDirect binding measurementMay not predict functional effects

Lead Optimization Considerations:

  • Compound Properties:

    • Optimize for stability in soil environments

    • Design for appropriate plant uptake and translocation

    • Consider formulation for effective delivery to infection sites

  • Selectivity Assessment:

    • Test activity against human and plant potassium channels

    • Evaluate effects on beneficial soil microorganisms

    • Assess potential environmental impacts

  • Resistance Management:

    • Design combination approaches targeting multiple systems

    • Develop structural analogs to address potential resistance mutations

    • Model population dynamics under selection pressure

By specifically targeting unique features of kdpC that differ from host potassium channels, researchers may develop selective inhibitors that control R. solanacearum without adverse effects on crops or beneficial microorganisms, potentially providing new tools for managing bacterial wilt in agriculture.

How can advanced imaging techniques enhance our understanding of kdpC function?

Advanced imaging techniques provide powerful tools for investigating kdpC localization, dynamics, and function in Ralstonia solanacearum:

Super-Resolution Microscopy Approaches:

  • Single-Molecule Localization Microscopy (SMLM):

    • Tag kdpC with photoactivatable fluorescent proteins (PAmCherry, mEos)

    • Achieve 20-30 nm resolution to visualize kdpC distribution in bacterial membranes

    • Monitor changes in localization patterns under varying potassium concentrations

    • Investigate co-localization with other Kdp-ATPase components

  • Stimulated Emission Depletion (STED) Microscopy:

    • Visualize kdpC distribution with ~50 nm resolution

    • Perform live-cell imaging to track dynamic changes

    • Combine with immunolabeling for multifactor imaging

Functional Imaging Methods:

  • Förster Resonance Energy Transfer (FRET):

    • Create kdpC fusion proteins with appropriate FRET pairs

    • Monitor conformational changes during transport cycle

    • Measure protein-protein interactions between kdpC and other Kdp-ATPase subunits

    • Assess effects of inhibitors on protein dynamics

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Measure lateral mobility of kdpC in the membrane

    • Compare diffusion rates under varying conditions

    • Identify factors affecting kdpC clustering and mobility

In Planta Imaging:

  • Confocal Microscopy with Reporter Strains:

    • Create R. solanacearum strains expressing fluorescently tagged kdpC

    • Track bacterial colonization and kdpC expression during infection

    • Correlate kdpC levels with disease progression

    • Perform time-lapse imaging to capture dynamic changes

  • Multi-Photon Microscopy for Deep Tissue Imaging:

    • Visualize bacteria in planta with minimal photodamage

    • Track kdpC-expressing bacteria in xylem vessels

    • Correlate bacterial localization with local K+ concentrations

Correlative Light and Electron Microscopy (CLEM):

  • Workflow Implementation:

    • Locate kdpC-expressing bacteria using fluorescence microscopy

    • Process the same sample for electron microscopy

    • Create composite images showing ultrastructural context

    • Achieve nanometer-scale resolution of kdpC localization

These advanced imaging approaches can provide unprecedented insights into kdpC distribution, dynamics, and function in both laboratory cultures and during plant infection, helping to bridge the gap between molecular mechanisms and pathogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.