Recombinant Ralstonia solanacearum Probable intracellular septation protein A (RSc1746)

Shipped with Ice Packs
In Stock

Description

Physical and Chemical Properties

The physical and chemical properties of recombinant RSc1746 are summarized in Table 1, based on the available information from commercial sources:

PropertyCharacteristic
Length186 amino acids
Expression SystemE. coli
TagN-terminal His-tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage ConditionsRecommended -20°C/-80°C
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL) with 5-50% glycerol

The protein demonstrates reasonable stability when properly stored, though repeated freeze-thaw cycles are not recommended, suggesting some sensitivity to structural disruption during temperature transitions .

Recombinant Production and Applications

The recombinant production of RSc1746 involves heterologous expression in Escherichia coli, a common host for bacterial protein production. The addition of an N-terminal histidine tag facilitates purification through affinity chromatography techniques, allowing for the isolation of high-purity protein suitable for various research applications . The commercial availability of this recombinant protein suggests its potential utility in functional studies, antibody production, or structural analyses.

Expression and Purification Considerations

Successful expression of membrane proteins like RSc1746 presents particular challenges due to their hydrophobic nature and potential toxicity to host cells. The E. coli expression system used for RSc1746 production must overcome these challenges through optimized growth conditions, appropriate promoter selection, and refined purification protocols to maintain protein integrity. The resulting recombinant protein is supplied as a lyophilized powder with recommended reconstitution in deionized sterile water to achieve concentrations suitable for experimental use (0.1-1.0 mg/mL) .

For long-term storage, the addition of glycerol (5-50% final concentration) is recommended to prevent structural damage during freeze-thaw cycles, with a default recommendation of 50% glycerol . These handling recommendations reflect the general challenges associated with maintaining membrane protein stability in vitro.

Ralstonia solanacearum: Pathogenicity and Virulence Mechanisms

To contextualize the potential significance of RSc1746, it is important to understand the biology of Ralstonia solanacearum. This gram-negative bacterium is responsible for bacterial wilt, a devastating disease affecting over 200 plant species worldwide, including economically important crops like tomato, potato, banana, and ginger .

R. solanacearum's pathogenicity relies on multiple virulence factors, with extracellular polysaccharide (EPS) being particularly significant. EPS plays a dual role in the disease process:

  1. Physical obstruction of plant water transport systems, contributing to characteristic wilting symptoms

  2. Interaction with plant defense systems, potentially either evading detection or triggering defense responses depending on the host's resistance profile

Research on tomato plants has demonstrated that R. solanacearum infection triggers plant defense responses through both ethylene (ET) and salicylic acid (SA) pathways, with resistant tomato varieties showing more rapid and robust defense activation . Interestingly, in resistant plants, the bacterial EPS appears to be specifically recognized as a pathogen-associated molecular pattern, triggering defense responses including the production of reactive oxygen species (ROS) .

Signaling Systems in R. solanacearum

R. solanacearum employs sophisticated signaling systems to regulate virulence and adapt to environmental conditions. Research has identified the importance of nucleotide second messengers in these regulatory networks. Specifically, the RSp0334/2′,3′-cGMP/RSp0980 signaling system has been shown to play a crucial role in controlling quorum sensing, biofilm formation, motility, and virulence .

The second messenger 2',3'-cyclic guanosine monophosphate (2',3'-cGMP) regulates these processes by binding to the transcriptional regulator RSp0980, thereby altering its interaction with target gene promoters . This demonstrates the complexity of regulatory networks governing R. solanacearum pathogenicity.

Potential Roles of RSc1746 in Bacterial Physiology

Based on its designation as a "probable intracellular septation protein," RSc1746 is likely involved in bacterial cell division processes. Cell septation is a critical phase in bacterial reproduction wherein the cytoplasm is divided, and a new cell wall forms between daughter cells. Proteins involved in this process are typically essential for bacterial viability and often serve as potential targets for antimicrobial development.

Septation Proteins in Bacterial Cell Division

Bacterial septation requires the coordinated action of multiple proteins that form a complex known as the divisome. While specific information about RSc1746's role is limited in the available research, its membrane-spanning topology suggests it may participate in:

  1. Formation of the division septum

  2. Coordination of cell wall synthesis at the division site

  3. Membrane remodeling during cell division

  4. Spatial regulation of the division machinery

The alternative name "YciB" suggests homology to proteins in other bacterial species, potentially indicating conserved functions across different bacteria . In other bacterial systems, YciB family proteins have been associated with membrane integrity and cell division, though their precise mechanistic roles often remain incompletely characterized.

Potential Connection to Pathogenicity

While direct evidence linking RSc1746 to virulence mechanisms is not present in the available research, bacterial cell division and growth are fundamentally connected to pathogenicity. Efficient bacterial replication is necessary for successful colonization of host tissues and progression of disease. Therefore, proteins involved in cell division, like RSc1746, may indirectly contribute to bacterial virulence through their effects on population growth and adaptation within host environments.

Research Applications and Future Directions

The availability of recombinant RSc1746 protein enables several potential research applications that could advance understanding of both bacterial cell division mechanisms and R. solanacearum pathogenicity.

Potential Research Applications

  1. Structural Studies: Purified recombinant RSc1746 could be subjected to structural analysis techniques including X-ray crystallography or cryo-electron microscopy to determine its three-dimensional structure, providing insights into its function.

  2. Protein-Protein Interaction Studies: Identifying binding partners of RSc1746 would help elucidate its role in the divisome complex and potentially reveal connections to other cellular processes.

  3. Antibody Development: The recombinant protein could be used to generate specific antibodies for immunolocalization studies to determine the precise subcellular location of RSc1746 during different stages of the bacterial life cycle.

  4. Functional Assays: In vitro assays using the purified protein could investigate potential enzymatic activities or structural roles in membrane systems.

Future Research Directions

Several key questions remain to be addressed regarding RSc1746:

  1. Precise Cellular Function: Determining the exact role of RSc1746 in bacterial cell division through genetic and biochemical approaches.

  2. Impact on Virulence: Investigating whether mutations in RSc1746 affect R. solanacearum growth in planta and its ability to cause disease.

  3. Regulation: Examining how RSc1746 expression and activity are regulated, particularly in relation to other virulence factors like extracellular polysaccharides.

  4. Integration with Signaling Networks: Exploring potential connections between RSc1746 and known signaling pathways in R. solanacearum, such as the RSp0334/2′,3′-cGMP/RSp0980 system identified in recent research .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; RSc1746; RS02934; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
RSc1746
Target Protein Sequence
MKFLFDLFPVILFFAAFKVAGIYVATTVAMVATVAQIAWVWFKHRKVDAMQWLSLLIIVV FGGATLIFHNDTFIKWKPTVLYWMFGVVLLGSAVLLRKNLIRAMMEQQVSLPEPMWGRLN LVWSLFFLAMGGLNLYVAYHFDTDVWVNFKLFGSMGLMVVFILVQSVWLARHMQERPAGA NPQDDR
Uniprot No.

Target Background

Function
This protein plays a role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links

KEGG: rso:RSc1746

STRING: 267608.RSc1746

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is RSc1746 and what is its role in Ralstonia solanacearum?

RSc1746 is a probable intracellular septation protein A found in Ralstonia solanacearum, a soil-borne bacterial plant pathogen that causes bacterial wilt in many economically important crops. As an intracellular septation protein, RSc1746 likely plays a crucial role in bacterial cell division and the formation of the septum, which is essential for bacterial proliferation and survival.

The full-length protein consists of 186 amino acids and can be recombinantly expressed with a histidine tag in E. coli expression systems . While the specific molecular mechanisms of RSc1746 are not fully characterized, it belongs to a family of proteins involved in bacterial cell division machinery, which coordinates the placement and formation of the division septum during bacterial reproduction.

To study RSc1746's role, researchers typically employ gene knockout studies combined with microscopic examination of cell morphology and division patterns. Comparative genomic approaches with other bacterial septation proteins can also provide insights into its evolutionary conservation and functional importance.

How does RSc1746 relate to bacterial virulence mechanisms?

While direct evidence linking RSc1746 to virulence is limited in the available literature, research on Ralstonia solanacearum has demonstrated that bacterial cell division and septation proteins often indirectly impact virulence mechanisms. Proper bacterial growth and division, which depend on functional septation proteins like RSc1746, are prerequisites for successful host colonization and pathogenicity.

Ralstonia solanacearum employs complex signaling systems including cyclic nucleotide-based second messengers that regulate important biological functions such as quorum sensing (QS) signaling systems and virulence . Studies on related proteins like RSp0334, which contains an evolved GGDEF domain, have shown significant effects on biofilm formation, motility, cellulase production, and extracellular polysaccharide (EPS) production when deleted . These are all critical virulence factors in R. solanacearum.

To investigate potential links between RSc1746 and virulence, researchers could employ gene deletion studies combined with virulence assays in plant models, transcriptomic analyses to identify co-regulated genes, and protein interaction studies to map connections with known virulence factors.

What expression systems are most efficient for producing recombinant RSc1746?

For producing recombinant RSc1746, E. coli expression systems have proven effective, as evidenced by successful production of His-tagged full-length RSc1746 protein . When selecting an expression system, researchers should consider several factors specific to this bacterial protein:

  • Codon optimization: Adjusting codons to match E. coli preferences can significantly improve expression levels, especially since Ralstonia and E. coli have different codon usage patterns.

  • Vector selection: pET vector systems with T7 promoters often provide high-level expression for bacterial proteins like RSc1746.

  • Host strain selection: BL21(DE3) and its derivatives are commonly used for recombinant bacterial protein expression, with strains like Rosetta addressing rare codon issues.

  • Induction conditions: Optimization of IPTG concentration, temperature, and induction time is critical - lower temperatures (16-25°C) often improve solubility of bacterial division proteins.

  • Solubility enhancement: Fusion tags beyond the His-tag, such as MBP (maltose-binding protein) or SUMO, might improve solubility if the native protein tends to form inclusion bodies.

Expression yields can be monitored using SDS-PAGE and Western blotting with anti-His antibodies, while protein activity can be assessed through functional assays specific to septation proteins.

How does RSc1746 interact with cyclic nucleotide signaling systems in Ralstonia solanacearum?

Recent research has highlighted the importance of cyclic nucleotide signaling in Ralstonia solanacearum biology. While specific interactions between RSc1746 and these signaling systems remain to be fully characterized, exploring potential connections represents an important research direction.

Ralstonia solanacearum utilizes 2',3'-cyclic guanosine monophosphate (2',3'-cGMP) as a second messenger that controls biological functions including quorum sensing and virulence through specific transcriptional regulators . The protein RSp0334, containing an evolved GGDEF domain with a LLARLGGDQF motif, catalyzes 2',3'-cGMP to (2',5')(3',5')-cyclic diguanosine monophosphate (2',3'-c-di-GMP) . Deletion of RSp0334 significantly affects biofilm formation, motility, and virulence factor production.

To investigate potential interactions between RSc1746 and these signaling pathways, researchers should consider:

  • Comparative phenotypic analysis of RSc1746 and RSp0334 deletion mutants to identify overlapping functions

  • Co-immunoprecipitation studies to detect physical interactions between RSc1746 and components of cyclic nucleotide signaling pathways

  • Measurement of cyclic nucleotide levels in RSc1746 mutants using LC-MS/MS

  • Transcriptomic analysis to identify genes co-regulated by both RSc1746 and cyclic nucleotide signaling

These approaches could reveal whether RSc1746 functions within or parallel to these important regulatory networks in Ralstonia solanacearum.

What structural features of RSc1746 contribute to its function in bacterial cell division?

Understanding the structural basis of RSc1746 function requires integrating computational prediction with experimental structure determination. While specific structural data for RSc1746 is limited in current literature, researchers can employ several approaches:

  • Homology modeling: Identifying structural homologs of RSc1746 in related bacteria can provide templates for computational modeling. Septation proteins often contain conserved domains that mediate protein-protein interactions or enzymatic activities.

  • Domain identification: Bioinformatic analysis can reveal functional domains within RSc1746, such as potential peptidoglycan-binding domains, protein interaction motifs, or nucleotide-binding regions.

  • Experimental structure determination: X-ray crystallography or cryo-electron microscopy of purified RSc1746 would provide high-resolution structural information. For challenging proteins, NMR spectroscopy of specific domains can be an alternative approach.

  • Molecular dynamics simulations: Once a structural model is established, MD simulations can predict protein flexibility, identify potential binding pockets, and model interactions with other septation proteins or the cell membrane.

  • Structure-guided mutagenesis: Based on structural predictions, targeted mutations can be introduced to test the functional importance of specific residues or domains in vivo.

Researchers studying similar bacterial proteins have successfully applied molecular dynamics simulations to understand protein-ligand interactions , which could be adapted for studying RSc1746's structural dynamics during septation.

How does deletion of RSc1746 affect transcriptional networks in Ralstonia solanacearum?

Deletion of proteins involved in fundamental cellular processes like septation often triggers complex transcriptional responses. Studies on related Ralstonia solanacearum proteins provide methodological approaches for investigating RSc1746's impact on gene expression networks.

When studying the RSp0334 deletion mutant, researchers observed significant effects on the expression of key regulatory genes including phcB, solI, and trpEG, as measured by lacZ fusion reporter assays . Similar approaches could be applied to RSc1746 deletion mutants.

To comprehensively characterize transcriptional changes, researchers should consider:

  • RNA-Seq analysis comparing wild-type and ΔRSc1746 strains under various growth conditions

  • ChIP-Seq to identify any direct DNA interactions if RSc1746 has potential DNA-binding domains

  • Reporter fusion assays for key virulence and metabolism genes

  • Quantitative RT-PCR validation of differentially expressed genes

  • Comparative analysis with transcriptome data from other septation protein mutants

These approaches would reveal whether RSc1746 affects specific pathways beyond its direct role in septation, potentially uncovering new connections between cell division and virulence in this important plant pathogen.

What protein purification strategies are optimal for obtaining functional RSc1746?

Purifying bacterial septation proteins like RSc1746 requires specialized approaches to maintain protein functionality. Based on successful purification of other bacterial proteins including those from Ralstonia solanacearum, the following stepwise protocol is recommended:

  • Affinity chromatography: Since RSc1746 can be expressed with a histidine tag , nickel or cobalt affinity chromatography provides an effective first purification step. Optimization of imidazole concentration in binding and elution buffers is critical to reduce non-specific binding while maximizing target protein recovery.

  • Buffer optimization: Septation proteins often require specific buffer conditions to maintain stability and solubility. Testing various pH values (typically 7.0-8.0), salt concentrations (150-500 mM NaCl), and stabilizing agents (5-10% glycerol, 1-5 mM DTT) is recommended.

  • Secondary purification: Size exclusion chromatography (SEC) following affinity purification can remove aggregates and provide information about the oligomeric state of RSc1746.

  • Quality assessment: Purified protein should be analyzed by SDS-PAGE, Western blotting, and dynamic light scattering to confirm purity, identity, and monodispersity.

  • Activity validation: Functional assays specific to septation proteins, such as GTPase activity measurements or interaction studies with known septation partners, should be employed to confirm that the purified protein maintains its native activity.

For structural studies, additional purification steps such as ion exchange chromatography may be necessary to achieve >95% purity. When performing biochemical characterization, researchers should be aware that the His-tag might affect certain protein properties, necessitating tag removal via specific proteases for some applications.

How can researchers effectively generate and characterize RSc1746 mutants?

Creating and characterizing mutants is essential for understanding RSc1746 function. Based on successful approaches with other Ralstonia solanacearum proteins , researchers should consider:

  • Deletion strategy: In-frame deletion of RSc1746 using homologous recombination is preferred over insertion-based disruption to avoid polar effects on downstream genes. The SacB-based counter-selection system works well in Ralstonia solanacearum.

  • Complementation: Reintroducing RSc1746 in trans using a plasmid with a native or controlled promoter is essential to confirm that observed phenotypes are specific to the RSc1746 deletion.

  • Site-directed mutagenesis: Beyond complete deletion, introducing specific mutations to alter key residues can provide insights into structure-function relationships.

  • Phenotypic characterization: Comprehensive phenotyping should include:

    • Growth curve analysis in different media conditions

    • Microscopic examination of cell morphology and division

    • Biofilm formation assays

    • Motility assays (swimming, swarming, twitching)

    • Production of virulence factors (cellulase, EPS)

    • Plant virulence assays

  • Molecular characterization: Beyond phenotypic analysis, molecular approaches should include:

    • Transcriptomic analysis of the mutant strain

    • Protein localization studies using fluorescent fusion proteins

    • Protein interaction studies using pull-down assays or bacterial two-hybrid systems

When designing experiments with RSc1746 mutants, it's important to note that deletion of essential septation proteins might be lethal or cause severe growth defects, requiring conditional mutation approaches such as inducible promoters or temperature-sensitive alleles.

What imaging techniques are most informative for studying RSc1746 localization and dynamics?

Visualization of septation proteins provides crucial insights into their function during bacterial cell division. For RSc1746, several advanced imaging approaches should be considered:

  • Fluorescent protein fusions: Creating N- or C-terminal fusions of RSc1746 with fluorescent proteins (GFP, mCherry) allows for live-cell imaging of protein localization. Care must be taken to ensure the fusion doesn't disrupt protein function, which can be verified by complementation testing.

  • Super-resolution microscopy: Techniques like Structured Illumination Microscopy (SIM), Stimulated Emission Depletion (STED), or Single-Molecule Localization Microscopy (PALM/STORM) can overcome the diffraction limit, providing nanoscale resolution of septation protein localization.

  • Time-lapse microscopy: Capturing the dynamics of RSc1746 throughout the cell cycle requires time-lapse imaging on microfluidic platforms that maintain stable growth conditions while allowing long-term observation.

  • Correlative light and electron microscopy (CLEM): This approach combines fluorescence microscopy with electron microscopy to correlate protein localization with ultrastructural features of the division septum.

  • Fluorescence Recovery After Photobleaching (FRAP): This technique can reveal the mobility and turnover rate of RSc1746 at the division site by measuring how quickly fluorescent signal recovers after photobleaching.

  • Single-particle tracking: For advanced studies, tracking individual molecules of fluorescently labeled RSc1746 can provide insights into protein movement and binding kinetics.

When designing imaging experiments, researchers should optimize fixation protocols if using immunofluorescence, as some fixatives may affect septum structure. Additionally, growth conditions dramatically affect bacterial cell division, so imaging should be performed under consistent and physiologically relevant conditions.

What are the potential applications of RSc1746 research in controlling bacterial wilt disease?

Understanding RSc1746 and its role in Ralstonia solanacearum biology could lead to novel control strategies for bacterial wilt disease, which causes significant agricultural losses worldwide. Several potential applications emerge:

  • Antimicrobial development: If RSc1746 proves essential for bacterial growth or division, it could serve as a target for new antimicrobial compounds. Virtual screening and structure-based drug design approaches, similar to those used for other bacterial targets , could identify inhibitors specific to RSc1746.

  • Virulence attenuation: If RSc1746 contributes to virulence beyond its role in septation, targeting it could reduce pathogenicity without strong selection pressure for resistance that comes with growth inhibition.

  • Diagnostic development: Knowledge of RSc1746 could contribute to improved molecular diagnostics for Ralstonia solanacearum detection in soil, water, or plant material, potentially through antibody-based or nucleic acid-based methods.

  • Resistant crop development: Understanding the interaction between RSc1746 and plant host factors could inform breeding programs or genetic engineering approaches to enhance crop resistance.

  • Biocontrol strategies: Insights into RSc1746's role in bacterial physiology could help design biocontrol agents that specifically target vulnerabilities in Ralstonia solanacearum's life cycle.

When pursuing these applications, researchers should consider the conservation of RSc1746 across Ralstonia species and strains to develop broadly effective control strategies, while also accounting for potential effects on beneficial soil microorganisms.

How can computational approaches enhance our understanding of RSc1746 function?

Computational methods offer powerful tools for studying proteins like RSc1746, especially when experimental data is limited. Researchers should consider several approaches:

  • Phylogenetic analysis: Comparing RSc1746 sequences across bacterial species can reveal evolutionary conservation patterns, helping identify functionally important residues and domains. This approach has proven valuable for understanding protein function in diverse bacterial species.

  • Protein-protein interaction prediction: Computational tools can predict potential binding partners of RSc1746 within the septation machinery and beyond, generating testable hypotheses about its functional network.

  • Molecular dynamics simulations: Similar to approaches used for studying protein-ligand interactions , MD simulations can model RSc1746's structural dynamics, potential conformational changes during septation, and interactions with other proteins or membranes.

  • Systems biology modeling: Integrating RSc1746 into broader models of bacterial cell division or virulence networks can predict system-level effects of mutations or inhibition.

  • Virtual screening: If pursuing RSc1746 as an antimicrobial target, virtual screening of compound libraries can identify potential inhibitors for experimental validation.

  • Machine learning approaches: Emerging AI methods can identify patterns in multi-omics datasets that might reveal non-obvious connections between RSc1746 and other cellular processes.

These computational approaches are most powerful when integrated with experimental validation, creating an iterative process of prediction and testing that accelerates scientific discovery.

What emerging technologies could revolutionize research on bacterial septation proteins like RSc1746?

Several cutting-edge technologies hold promise for advancing our understanding of RSc1746 and similar bacterial septation proteins:

  • Cryo-electron tomography: This technique allows visualization of proteins in their native cellular context at near-atomic resolution, potentially revealing the 3D architecture of the division septum and RSc1746's position within it.

  • Proximity labeling proteomics: Methods like BioID or APEX2 can identify proteins in close proximity to RSc1746 in living cells, mapping its interactome with spatial and temporal resolution.

  • Single-cell transcriptomics: This approach can reveal how gene expression patterns, including those influenced by RSc1746, vary across individual bacterial cells and throughout the cell cycle.

  • CRISPR interference (CRISPRi): For essential genes like septation proteins, CRISPRi provides tunable repression rather than complete knockout, allowing the study of protein function across a range of expression levels.

  • Microfluidic techniques: Advanced microfluidic devices enable precise control of bacterial growth environments while facilitating long-term imaging, mechanical measurements, or rapid environmental shifts.

  • AlphaFold and other AI-based structure prediction: Recent advances in protein structure prediction can provide high-confidence structural models of RSc1746, even in the absence of experimental structures.

  • Expanded genetic code technologies: Incorporating non-canonical amino acids into RSc1746 could enable precise biophysical studies, including site-specific fluorescent labeling or photocrosslinking to capture transient interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.