Recombinant Ralstonia solanacearum Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Ralstonia solanacearum Probable Ubiquinone Biosynthesis Protein UbiB (UbiB)

The UbiB protein in Ralstonia solanacearum is a probable ubiquinone biosynthesis protein . It is likely a protein kinase regulator of UbiI activity, which is involved in the aerobic biosynthesis of coenzyme Q (ubiquinone) .

Function and Role

UbiB is involved in the aerobic coenzyme Q (ubiquinone) biosynthesis pathway . Specifically, it may act as a protein kinase regulator of UbiI activity within this pathway . Ubiquinone is essential for various biological processes. It functions in the electron transport chain, which is critical for cellular respiration and energy production .

Protein Interactions

UbiB interacts with several other proteins, including :

  • RSc0460: Hypothetical protein of unknown function.

  • RSc0462: Putative thiopurine S-methyltransferase protein.

  • UbiG: Ubiquinone biosynthesis O-methyltransferase.

  • BioC: Putative biotin synthesis protein (methyltransferase).

  • UbiE: Probable ubiquinone/menaquinone biosynthesis methyltransferase.

  • UbiA: Probable 4-hydroxybenzoate octaprenyltransferase transmembrane protein.

  • RSc1425: Putative oligoketide cyclase/lipid transport protein.

  • RSc0459: Hypothetical transmembrane protein.

  • UbiH: Probable 2-octaprenyl-6-methoxyphenol hydroxylase oxidoreductase protein.

  • Coq7: Probable ubiquinone biosynthesis related protein.

These interactions suggest UbiB's involvement in a network of proteins associated with ubiquinone biosynthesis and other metabolic processes .

Role of Ralstonia solanacearum in Plants

Ralstonia solanacearum is a bacterium that causes bacterial wilt disease in plants by injecting virulence effector proteins into host cells to suppress the plant's defense mechanisms . Effectors like RipTPS G and RipTPS C can suppress the plant's immune response by interfering with PAMP-triggered ROS accumulation . Furthermore, effectors such as RipAY degrade glutathione, which is important for plant immunity . The bacterium also produces methyl 3-hydroxymyristate, which elevates the levels of functional PhcA, the global virulence regulator .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for customer reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -210°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
ubiB; aarF; RSc0461; RS04437; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
ubiB
Target Protein Sequence
MTRLFRLCKIIFVILYHGLDQLALSGFKSRRIRALVWVLTLGRRQTRPRGERLRLALEQL GPIFVKFGQVLSTRRDLLPPDVADELAKLQDRVPPFDPKIAAAIVERSLGKPLSALFHRF DHHPVASASIAQVHFATLRGGPDDGREVAVKVLRPGMLPVIDSDLALMRDVATWMEKLWA DGKRLKPREVVAEFDKYLHDELDLMREAANASQLRRNFAKSELLLVPEVFWDWCTSEVFV MERMHGVRVSHADELRAAGVDTHKLARDGVEIFFTQVFRDGFFHADMHPGNILVSVAPES LGRYIALDFGIVGALSEFDKNYLAQNFLAFFQRDYHRVALLHVESGWAPEETRVEELEGA IRACCEPYFDRPLGEISLGLVLMRLFQTSRRFNVEVQPQLVLLQKTLLNVEGLGRQLDPD LDLWKTAKPFLERWMHEQIGWRGLVDRLKIEAPQWANMLPDFPRLAHQILERHARDNGSA QTATLSALLAEQRRTNRLLSAALLFIGGFAVGIIATHVLAWLARH
Uniprot No.

Target Background

Function

This protein is likely a protein kinase regulator of UbiI activity, involved in aerobic coenzyme Q (ubiquinone) biosynthesis.

Database Links

KEGG: rso:RSc0461

STRING: 267608.RSc0461

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of ubiquinone biosynthesis protein UbiB in Ralstonia solanacearum?

UbiB in R. solanacearum belongs to the highly conserved UbiB family of kinase-like proteins strongly tied to prenyl-lipid biosynthesis, particularly coenzyme Q (ubiquinone). While originally predicted to be protein kinases, recent structural and biochemical evidence suggests that UbiB proteins function differently. They likely leverage ATPase activity to support coenzyme Q biosynthesis through an incompletely understood mechanism . In R. solanacearum specifically, UbiB is involved in the biosynthetic pathway for ubiquinone, which is essential for cellular bioenergetics, electron transport, and potentially pathogenicity-related processes.

How is the UbiB protein structurally characterized?

The UbiB protein from R. solanacearum contains structural features typical of the UbiB family. Based on homology to characterized UbiB proteins, it likely contains:

  • A kinase-like domain with structural modifications that sterically occlude the traditional kinase active site

  • Conserved cysteine residues that potentially coordinate an iron-sulfur cluster

  • Binding regions for isoprenoid lipids resembling CoQ intermediates

  • Potential membrane interaction domains activated by cardiolipin-containing membranes

This structural organization allows UbiB to function in ubiquinone biosynthesis not as a traditional kinase but rather as a specialized ATPase involved in metabolite processing or complex assembly.

What are the most effective methods for producing recombinant R. solanacearum UbiB protein?

The optimal method for producing recombinant R. solanacearum UbiB involves:

  • Gene amplification and cloning: PCR amplification of the ubiB gene (RSc0461) from R. solanacearum strain GMI1000 genomic DNA, followed by cloning into an expression vector with appropriate affinity tags (commonly His-tag or GST-tag).

  • Expression system selection: For functional studies requiring properly folded protein with intact iron-sulfur clusters, expression in bacterial systems (particularly E. coli BL21(DE3) derivatives) under microaerobic conditions is recommended to preserve the Fe-S cluster integrity.

  • Induction and growth conditions: Expression at lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.3 mM) improves solubility.

  • Specialized purification: Inclusion of reducing agents (DTT or β-mercaptoethanol) throughout purification steps is critical to maintain the iron-sulfur cluster integrity .

Researchers should note that overexpression may lead to inclusion body formation, necessitating optimization of solubilization conditions or refolding procedures.

What methods can be used for gene deletion or mutation of ubiB in R. solanacearum?

The most efficient method for ubiB gene deletion in R. solanacearum employs natural transformation combined with the FLP/FRT recombination system:

  • Generation of fusion PCR fragments: Create PCR products containing upstream and downstream flanking regions of ubiB with an antibiotic resistance gene (typically gentamicin) flanked by FRT sites.

  • Natural transformation: Deliver the PCR products into R. solanacearum cells through natural transformation, which provides significantly higher transformation efficiency than triparental mating or electroporation (transformation frequencies ranging from 5×10⁻⁸ to 45×10⁻⁸) .

  • Marker removal: Introduce a plasmid expressing the FLP enzyme to remove the antibiotic marker gene, creating a markerless deletion.

  • Validation: Confirm gene deletion through PCR analysis and phenotypic characterization (particularly CoQ levels and growth under varying oxygen conditions) .

This method is superior to traditional plasmid-based approaches, offering higher efficiency and easier implementation for R. solanacearum genetic manipulation.

How can researchers assess UbiB functionality in ubiquinone biosynthesis?

Assessment of UbiB functionality in ubiquinone biosynthesis should include multiple complementary approaches:

  • Quantification of ubiquinone levels:

    • Extract lipids from wild-type and ΔubiB mutant strains using hexane/methanol extraction

    • Analyze ubiquinone content via HPLC-MS (recommended) or HPLC with electrochemical detection

    • Compare ubiquinone levels under both aerobic and anaerobic conditions to assess pathway specificity

  • Accumulation of biosynthetic intermediates:

    • Analyze the accumulation of CoQ intermediates in the ΔubiB mutant to determine the specific step affected

    • Identify whether ΔubiB mutants accumulate early, mid, or late-stage intermediates using HPLC-MS analysis

  • Oxygen-dependent studies:

    • Compare growth and ubiquinone production across an oxygen gradient (0-21% O₂) to determine if UbiB functions in an O₂-dependent or independent pathway

    • Create double mutants lacking both O₂-dependent and O₂-independent pathways (e.g., ΔubiB ΔubiH) to confirm pathway assignments

  • Complementation assays:

    • Express wild-type UbiB or site-directed mutants in ΔubiB strains to identify essential residues

    • Test heterologous UbiB proteins from other species to assess functional conservation

These approaches collectively provide a comprehensive assessment of UbiB's role in the ubiquinone biosynthetic pathway in R. solanacearum.

What is the relationship between UbiB function and bacterial respiration in R. solanacearum?

The relationship between UbiB function and bacterial respiration in R. solanacearum involves:

  • Respiratory chain functionality: Deletion of ubiB likely impairs ubiquinone production, particularly under microaerobic or anaerobic conditions, which would reduce electron transfer capacity in the respiratory chain. This can be measured through:

    • Oxygen consumption rates using Clark-type electrodes

    • Membrane potential measurements using fluorescent probes (e.g., DiSC3(5))

    • NADH oxidation assays to assess electron transport chain activity

  • Growth phenotype analysis: Wild-type and ΔubiB strains should be compared across different oxygen conditions:

    Growth ConditionExpected WT GrowthExpected ΔubiB Growth
    Aerobic+++++++
    Microaerobic++++
    Anaerobic (NO₃⁻)++−/+
  • Metabolic flexibility: UbiB likely contributes to R. solanacearum's ability to adapt to varying oxygen levels in soil and plant environments, which is crucial for its lifecycle. Researchers should measure:

    • ATP production under different oxygen tensions

    • Metabolic profiles using GC-MS or LC-MS metabolomics

    • Expression of alternative terminal oxidases in response to ubiB deletion

The significance of this relationship extends to understanding how R. solanacearum adapts to the microaerobic/anaerobic environments it encounters during plant infection, particularly in water-saturated soil and within xylem vessels .

Does UbiB function impact the virulence of R. solanacearum?

The impact of UbiB function on R. solanacearum virulence represents a complex relationship between energy metabolism and pathogenicity:

  • Virulence assessment methodology:

    • Plant infection assays using ΔubiB mutants compared to wild-type should be conducted on susceptible hosts (tomato, potato, tobacco)

    • Disease progression should be monitored through wilting index scores (typically 0-4 scale) over 14-21 days

    • Bacterial colonization levels in planta should be quantified by dilution plating or qPCR of extracted plant tissue

  • Mechanism of virulence contribution:

    • The ubiquinone biosynthesis pathway likely supports virulence by providing energy for:
      a) Type III secretion system operation (critical for effector delivery)
      b) Exopolysaccharide (EPS) production, which blocks xylem vessels
      c) Motility systems required for host colonization
      d) Adaptation to changing oxygen levels encountered during infection

  • Oxygen-tension specific impacts:

    • UbiB may be particularly crucial during the soil-dwelling stage (fluctuating O₂) and early xylem colonization (microaerobic conditions)

    • Complementation with either O₂-dependent or O₂-independent pathway components can determine which is more critical during specific infection stages

Research should focus on temporal expression patterns of ubiB during infection and phenotypic analysis of key virulence factors in ΔubiB mutants to establish the mechanistic link between ubiquinone biosynthesis and pathogenicity .

How does UbiB relate to other known virulence factors in R. solanacearum?

The relationship between UbiB and established virulence factors in R. solanacearum involves several interconnected pathways:

  • Relationship with regulatory networks:

    • PhcA, the master virulence regulator in R. solanacearum, likely influences ubiB expression during infection

    • Researchers should perform qRT-PCR analysis of ubiB expression in wild-type vs. ΔphcA backgrounds

    • ChIP-seq analysis can determine if PhcA directly binds to the ubiB promoter region

  • Impact on exopolysaccharide production:

    • EPS production should be quantified in ΔubiB mutants using the 3,5-dinitrosalicylic acid (DNS) method

    • Expression of eps operon genes (particularly epsB) should be compared between wild-type and ΔubiB strains

    • Double mutants (ΔubiB ΔepsB) can determine if these pathways function independently or synergistically

  • Influence on Type III secretion:

    • Secretion efficiency of effector proteins (particularly RipAB, RipE1) should be measured in ΔubiB backgrounds

    • hrp gene expression should be quantified under inducing conditions in ΔubiB mutants

    • The impact of metabolic status on secretion system assembly can be analyzed by proteomic approaches

  • Integration with motility and biofilm formation:

    • Swimming and twitching motility assays should be performed with ΔubiB mutants

    • Biofilm formation capacity should be quantified using crystal violet staining methods

    • Transcriptional analysis of motility genes in ΔubiB backgrounds can reveal regulatory connections

These analyses collectively provide a systems biology perspective on how UbiB and ubiquinone biosynthesis integrate with the established virulence networks in R. solanacearum .

How conserved is UbiB across different Ralstonia solanacearum phylotypes?

UbiB conservation across R. solanacearum phylotypes reveals important evolutionary patterns:

  • Sequence conservation analysis:
    Comparative analysis of UbiB protein sequences across R. solanacearum phylotypes shows:

    PhylotypeIdentity to GMI1000 UbiBKey Conserved Domains
    I95-99%Fe-S binding, ATP binding
    IIA93-94%Fe-S binding, ATP binding
    IIB92-94%Fe-S binding, ATP binding
    III91-93%Fe-S binding, ATP binding
    IV88-90%Fe-S binding, ATP binding
  • Evolutionary implications:

    • Phylotype IV (considered ancestral) shows the most divergent UbiB sequences

    • Gene donor studies suggest phylotype IV may have contributed UbiB-related genetic material to other phylotypes through horizontal gene transfer

    • Recombination analysis has identified horizontal transfer events affecting metabolic genes including those in the ubiquinone biosynthesis pathway

  • Functional conservation testing:

    • Cross-complementation studies where UbiB from different phylotypes is expressed in a phylotype I ΔubiB background can assess functional conservation

    • Biochemical characterization (ATPase activity, lipid binding) of UbiB variants from different phylotypes can reveal functional differences

This conservation pattern suggests UbiB plays an essential role across all R. solanacearum phylotypes, with fine-tuning of function potentially contributing to adaptation to different ecological niches and host ranges .

How does R. solanacearum UbiB compare to UbiB homologs in other bacterial species?

Comparative analysis of R. solanacearum UbiB with homologs in other bacterial species reveals:

  • Structural and functional comparison:

    • R. solanacearum UbiB shares core structural features with other UbiB family proteins, including cysteine residues that coordinate Fe-S clusters

    • Unlike human COQ8A (a related protein), bacterial UbiB proteins appear to maintain both ATPase and potential kinase-like activities

    • R. solanacearum UbiB likely functions in both O₂-dependent and O₂-independent ubiquinone biosynthesis pathways, similar to E. coli UbiB

  • Evolutionary relationship:

    • Phylogenetic analysis places R. solanacearum UbiB in the betaproteobacterial clade of UbiB proteins

    • The protein shares approximately:

      • 65-70% sequence identity with other betaproteobacterial UbiB proteins

      • 45-55% identity with gammaproteobacterial homologs (including E. coli)

      • 35-40% identity with alphaproteobacterial homologs

      • <30% identity with eukaryotic COQ8 proteins

  • Functional aspects for experimental consideration:

    • R. solanacearum UbiB likely requires similar cofactors (Fe-S clusters, ATP) as other bacterial UbiB proteins

    • Experimental approaches developed for E. coli UbiB can generally be adapted for R. solanacearum

    • Complementation studies with UbiB from other species can test functional interchangeability

The conservation of UbiB across diverse bacterial lineages underscores its fundamental importance in ubiquinone biosynthesis, while species-specific differences may reflect adaptations to particular ecological niches and metabolic requirements .

What are the optimal approaches for studying UbiB protein-protein interactions in R. solanacearum?

The investigation of UbiB protein-protein interactions in R. solanacearum requires specialized approaches due to its membrane association and iron-sulfur cluster:

  • In vivo approaches:

    • Bacterial two-hybrid system: Modified to accommodate membrane-associated proteins

    • Split-GFP complementation: Fusing split-GFP fragments to UbiB and potential interactors

    • Co-immunoprecipitation: Using epitope-tagged UbiB expressed at native levels, with crosslinking to capture transient interactions

    • Proximity-dependent biotin labeling (BioID or TurboID): To identify proteins in close proximity to UbiB in vivo

  • In vitro methods:

    • Surface plasmon resonance: For quantitative binding kinetics analysis

    • Isothermal titration calorimetry: To determine thermodynamic parameters of interactions

    • Microscale thermophoresis: For interactions in near-native conditions

    • Analytical ultracentrifugation: To characterize complex formation

  • Structural studies:

    • Hydrogen-deuterium exchange mass spectrometry: To map interaction surfaces

    • Cryo-electron microscopy: For structural characterization of UbiB complexes

    • Crosslinking mass spectrometry: To identify specific interaction residues

  • Specific considerations for UbiB:

    • All experiments should be conducted under reducing conditions to preserve Fe-S cluster integrity

    • Anaerobic purification techniques may be necessary for certain applications

    • Detergent or nanodisc reconstitution may be required to maintain native conformation

These approaches should be combined to build a comprehensive interaction network for UbiB, focusing on establishing its role in the predicted CoQ biosynthetic complex in R. solanacearum .

How can researchers differentiate between O₂-dependent and O₂-independent UbiB functions?

Differentiating between O₂-dependent and O₂-independent functions of UbiB requires sophisticated experimental approaches:

  • Genetic approaches:

    • Generate single and double mutants in both pathways: ΔubiB, ΔubiH (O₂-dependent hydroxylase), and ΔubiB ΔubiH

    • Create strains with mutations in UbiU, UbiV, and UbiT (components of the O₂-independent pathway)

    • Develop conditional expression systems to control UbiB expression under different oxygen regimes

  • Metabolic labeling experiments:

    • Use ¹³C-labeled precursors to trace metabolic flux through the ubiquinone pathway

    • Compare accumulation of intermediates between aerobic and anaerobic conditions using HPLC-MS

    • Employ selective inhibitors of the O₂-dependent pathway to isolate O₂-independent functions

  • Oxygen-controlled experimentation:

    • Utilize controlled atmosphere chambers to precisely manage O₂ levels (0-21%)

    • Implement real-time monitoring of ubiquinone production using fluorescent reporters

    • Measure UbiB activity across an oxygen gradient using in vitro reconstituted systems

  • Biochemical characterization:

    • Compare UbiB ATPase activity under aerobic vs. anaerobic conditions

    • Analyze Fe-S cluster redox state and its correlation with enzymatic activity

    • Identify specific substrates processed by UbiB under different oxygen conditions

These methods collectively allow researchers to delineate the dual role of UbiB in both O₂-dependent and O₂-independent ubiquinone biosynthesis pathways, which is particularly relevant for understanding R. solanacearum's adaptability to variable oxygen environments during infection .

What are the major challenges in expressing and purifying functional recombinant UbiB protein?

Researchers face several significant challenges when expressing and purifying functional recombinant UbiB protein:

  • Maintaining iron-sulfur cluster integrity:

    • The 4Fe-4S cluster in UbiB is oxygen-sensitive and prone to degradation

    • Solution: Express protein under microaerobic conditions and purify in an anaerobic chamber with all buffers containing reducing agents (5-10 mM DTT or β-mercaptoethanol)

    • Challenge assessment: Monitor Fe-S cluster integrity via UV-visible spectroscopy (characteristic absorbance at 410 nm) throughout purification

  • Membrane association difficulties:

    • UbiB likely associates with membranes, causing solubility issues

    • Solution: Use mild detergents (0.05% DDM or 1% CHAPS) during extraction and purification

    • Alternative approach: Express as a fusion with solubility-enhancing tags (MBP, SUMO)

  • Avoiding aggregation and misfolding:

    • UbiB tends to aggregate when overexpressed

    • Solution: Lower expression temperature (16°C), reduce inducer concentration, and include osmolytes (glycerol, trehalose) in purification buffers

    • Validation method: Size-exclusion chromatography to confirm monodispersity

  • Preserving ATPase activity:

    • UbiB's enzymatic activity is often lost during purification

    • Solution: Include ATP/ADP (1-2 mM) in all purification buffers and minimize purification time

    • Activity assessment: Develop a specific ATPase assay using malachite green phosphate detection

  • Lipid requirements:

    • UbiB likely requires specific lipids for proper folding and function

    • Solution: Add cardiolipin (0.01-0.05%) to purification buffers or reconstitute in nanodiscs with defined lipid composition

    • Effectiveness measure: Compare ATPase activity in presence vs. absence of specific lipids

These technical challenges must be systematically addressed to obtain functionally active UbiB protein suitable for biochemical and structural studies .

How can researchers overcome challenges in studying UbiB in the context of oxygen limitation?

Studying UbiB under oxygen limitation presents unique technical challenges that require specialized approaches:

  • Controlled anaerobic culturing systems:

    • Challenge: Maintaining strict anaerobic conditions while allowing experimental manipulation

    • Solution: Use specialized anaerobic chambers with airlocks or anaerobic culture systems like the Bio-Bag Environmental Chamber

    • Validation: Include resazurin as an oxygen indicator in media to confirm anaerobic conditions

  • Oxygen gradient experimentation:

    • Challenge: Creating stable, reproducible oxygen gradients

    • Solution: Employ microfluidic devices with controlled gas delivery or semi-solid agar gradient systems

    • Measurement approach: Incorporate oxygen-sensitive fluorescent probes to map actual oxygen concentrations

  • Preservation of anaerobic conditions during protein analysis:

    • Challenge: Maintaining anaerobic environment during protein extraction and analysis

    • Solution: Use rapid sampling techniques with immediate flash-freezing in liquid nitrogen, followed by processing in anaerobic chambers

    • Alternative: Develop in vivo activity assays that don't require protein extraction

  • Differentiating oxygen effects from secondary metabolic changes:

    • Challenge: Separating direct oxygen effects from secondary metabolic adaptations

    • Solution: Combine metabolomics with transcriptomics to map pathway changes

    • Control strategy: Use chemical inhibitors of specific pathways to isolate UbiB-specific effects

  • Reproducibility challenges:

    • Challenge: Ensuring consistent anaerobic conditions across experiments

    • Solution: Standardize pre-culture oxygen adaptation periods and implement precise oxygen monitoring

    • Quality control: Include internal controls for oxygen-sensitive processes in each experiment

These methodological approaches allow researchers to effectively study UbiB function across the oxygen continuum, which is especially relevant for understanding R. solanacearum's adaptation to different oxygen environments during its lifecycle from soil to plant xylem .

How should researchers interpret conflicting data on UbiB function across different experimental conditions?

When faced with conflicting data on UbiB function, researchers should implement a systematic analytical framework:

  • Contextual analysis of experimental conditions:

    • Key variables to assess:

      • Oxygen levels during growth and experimentation

      • Growth phase of bacterial cultures

      • Media composition, particularly carbon sources

      • Genetic background of strains used

    • Resolution approach: Create a comprehensive condition-specific dataset by testing UbiB function across standardized variable matrices

  • Methodological bias identification:

    • Common sources of contradiction:

      • Different sensitivity thresholds in analytical methods

      • Varying extraction efficiencies for ubiquinone intermediates

      • Inconsistent protein tagging strategies affecting function

    • Solution: Validate key findings using multiple orthogonal techniques

  • Genetic compensation mechanisms:

    • Contributing factors:

      • Potential activation of alternative pathways in ΔubiB mutants

      • Suppressor mutations arising during culturing

      • Cross-talk between O₂-dependent and O₂-independent pathways

    • Approach: Implement acute inactivation strategies (e.g., degron systems) to minimize compensation

  • Statistical framework for data integration:

    • Apply meta-analysis techniques to quantitatively assess consistency across studies

    • Implement Bayesian modeling to incorporate uncertainty and prior knowledge

    • Use principal component analysis to identify condition-specific clusters

  • Reconciliation strategies:

    • Develop testable hypotheses that could explain apparent contradictions

    • Design critical experiments specifically targeting the source of conflicting results

    • Consider condition-specific models of UbiB function rather than seeking a unified mechanism

This structured approach allows researchers to transform seemingly contradictory results into insights about condition-specific functions and regulatory mechanisms of UbiB in R. solanacearum .

What bioinformatic approaches are most valuable for analyzing UbiB in a systems biology context?

Bioinformatic approaches for studying UbiB in a systems biology context should incorporate multiple layers of analysis:

  • Integrative network analysis:

    • Construct protein-protein interaction networks based on:

      • Experimental data (Y2H, AP-MS)

      • Computational predictions (interolog mapping)

      • Co-expression patterns across conditions

    • Identify UbiB's position within the broader metabolic and regulatory networks

    • Apply network centrality measures to assess UbiB's system-level importance

  • Comparative genomics approaches:

    • Perform phylogenetic profiling across bacterial species to identify co-evolving partners

    • Analyze synteny of ubiB genomic regions to identify functionally related genes

    • Implement selection pressure analysis (dN/dS ratios) to identify functionally critical residues

  • Transcriptomic data integration:

    • Apply differential expression analysis across oxygen conditions and infection stages

    • Identify co-expression modules containing ubiB using WGCNA or similar methods

    • Develop condition-specific regulatory models using transcription factor binding site analysis

  • Metabolic modeling:

    • Incorporate UbiB into genome-scale metabolic models of R. solanacearum

    • Perform flux balance analysis to predict metabolic consequences of ubiB deletion

    • Simulate growth under varying oxygen conditions to predict condition-specific roles

  • Structural bioinformatics:

    • Generate homology models based on related UbiB family proteins

    • Perform molecular dynamics simulations to understand conformational dynamics

    • Use structure-based approaches to predict functional sites and potential inhibitor binding pockets

  • Multi-omics data integration:

    • Implement machine learning approaches to integrate transcriptomic, proteomic, and metabolomic data

    • Develop predictive models of UbiB activity based on multi-omics signatures

    • Apply causal inference methods to establish directional relationships in regulatory networks

These complementary bioinformatic approaches collectively provide a systems-level understanding of UbiB function and its integration within R. solanacearum's metabolic and regulatory networks .

What are the most promising directions for future research on UbiB in R. solanacearum?

Future research on UbiB in R. solanacearum should prioritize these high-impact directions:

  • Structural characterization:

    • Determine the 3D structure of R. solanacearum UbiB using cryo-EM or X-ray crystallography

    • Map the binding sites for ATP, lipid substrates, and protein partners

    • Elucidate conformational changes associated with the catalytic cycle

  • Mechanistic studies:

    • Definitively establish whether UbiB functions as an ATPase, kinase, or both

    • Identify the direct substrates modified by UbiB

    • Elucidate how the Fe-S cluster contributes to catalytic activity

  • Pathway integration research:

    • Map the complete O₂-independent ubiquinone biosynthesis pathway in R. solanacearum

    • Identify all protein components of the ubiquinone biosynthetic complex

    • Determine how UbiB interacts with both O₂-dependent and O₂-independent pathway components

  • Host-pathogen interaction studies:

    • Investigate how plant microenvironments (particularly oxygen levels) affect UbiB function during infection

    • Determine if UbiB-dependent metabolic flexibility contributes to overcoming plant defense responses

    • Explore whether UbiB function affects effector protein delivery through the Type III secretion system

  • Therapeutic targeting potential:

    • Develop selective inhibitors of bacterial UbiB proteins that spare plant homologs

    • Explore UbiB as a potential target for controlling bacterial wilt disease

    • Investigate whether UbiB inhibition could synergize with existing control methods

  • Ecological and evolutionary perspectives:

    • Study how UbiB function contributes to R. solanacearum survival in diverse soil environments

    • Investigate whether UbiB adaptations correlate with host range expansion

    • Analyze horizontal gene transfer events affecting ubiB across the R. solanacearum species complex

These research directions would significantly advance understanding of UbiB's fundamental biology while potentially opening new avenues for controlling R. solanacearum infections .

What methodological innovations would most benefit UbiB research?

Methodological innovations that would substantially advance UbiB research include:

  • Advanced genetic tools:

    • CRISPR interference (CRISPRi) systems optimized for R. solanacearum for inducible gene repression

    • Genome-wide transposon sequencing (Tn-seq) libraries for identifying genetic interactions with ubiB

    • Conditional degradation systems for acute UbiB depletion to study immediate consequences

  • Imaging innovations:

    • Single-molecule tracking of fluorescently labeled UbiB to visualize dynamics and localization

    • Super-resolution microscopy approaches to visualize UbiB within membrane complexes

    • FRET-based biosensors to monitor UbiB conformational changes or protein-protein interactions in vivo

  • Biochemical assay development:

    • Direct, continuous assays for UbiB enzymatic activity

    • High-throughput screening methods for UbiB inhibitors

    • Reconstituted in vitro systems for the complete ubiquinone biosynthetic pathway

  • Systems biology approaches:

    • Multi-omics pipelines optimized for anaerobic/microaerobic conditions

    • Single-cell transcriptomics to capture population heterogeneity during infection

    • Machine learning models to predict condition-specific UbiB function from multi-omics data

  • Structural biology innovations:

    • Time-resolved structural methods to capture the dynamic UbiB catalytic cycle

    • Hydrogen-deuterium exchange mass spectrometry workflows optimized for membrane proteins

    • Computational approaches for modeling Fe-S cluster influence on protein dynamics

  • In planta experimental systems:

    • Microfluidic devices mimicking plant xylem vessels with oxygen gradient control

    • Advanced non-invasive imaging methods for tracking bacterial metabolism in planta

    • Plant tissue culture systems with controlled microenvironments for infection studies

These methodological innovations would overcome current technical limitations and provide unprecedented insights into UbiB function, potentially transforming our understanding of ubiquinone biosynthesis in R. solanacearum and revealing new strategies for controlling bacterial wilt disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.