Recombinant Ralstonia solanacearum Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant Ralstonia solanacearum Protease HtpX homolog (htpX) is a transmembrane zinc metalloprotease expressed in E. coli and purified for research applications. Identified by the Uniprot ID Q8Y3A6, this enzyme belongs to the HtpX family of proteases, sharing structural and functional homology with bacterial quality control proteases .

Homologous Relationships

HtpX homologs are conserved across Gram-negative bacteria, with roles in:

  • Protein Quality Control: Degradation of misfolded membrane proteins .

  • Stress Adaptation: Interaction with stress-responsive genes in R. solanacearum (e.g., membrane stress response pathways) .

Production and Purification

Recombinant htpX is produced in E. coli with an N-terminal 10xHis-tag for affinity purification.

ParameterDetails
Product CodeCSB-CF849073RAR
Expression HostE. coli
TagN-terminal 10xHis-tag
Molecular WeightNot explicitly stated (estimated ~30–35 kDa based on sequence length)
PurityHigh-purity recombinant protein (via nickel affinity chromatography)

Role in Pathogen Biology

Though not directly studied, R. solanacearum htpX may:

  • Regulate Membrane Proteins: Similar to E. coli HtpX, which targets SecY for degradation .

  • Interact with Stress Systems: Potential links to membrane stress response (MSR) pathways in R. solanacearum .

Applications in Research

  1. Protease Activity Assays: Used to study bacterial protein quality control .

  2. Antimicrobial Target Identification: Comparisons with R. solanacearum ClpP (a validated protease target) .

  3. Structural Studies: N-terminal His-tag facilitates crystallography or NMR analyses .

Comparison with Related Proteases

ProteaseFunctionSubstratesStress ResponseSource
HtpXMembrane protein quality controlSecY, caseinMembrane stress
ClpPProtein degradation (ATP-dependent)Chemotaxis/flagellar proteinsGeneral proteostasis
RipE1Cysteine protease (T3E effector)Host Exo70B1, JAZ repressorsImmune evasion

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
htpX; RSc0074; RS02252; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
htpX
Target Protein Sequence
MFNWIKTFMLMAAITALFIVIGGMIGGRSGMMLALLFALGMNFFSYWFSDKMVLRMYNAQ EVSETTAPQFYRMVQELAGRAGLPMPRVYLIDEAQPNAFATGRNPEHAAVAATTGILNIL SERELRGVMAHELAHVQHRDILISTLSATMAGAISALANFAVFFGGRDEEGRPVNPIAGI AVAILAPLAASLIQMAISRAREFEADRGGAVISGDPQALASALDKIHRFAAGIPFAAAEA HPATAQMMIMNPLHGGGLANLFSTHPATEERIARLMHMAQTGTYPA
Uniprot No.

Target Background

Database Links

KEGG: rso:RSc0074

STRING: 267608.RSc0074

Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of HtpX proteases in bacterial systems?

HtpX proteases function as essential components of membrane protein quality control mechanisms in bacterial systems. These proteases identify and degrade misfolded or damaged membrane proteins that could otherwise compromise membrane integrity and cellular function. In E. coli, the HtpX protease works alongside other quality control systems to maintain membrane homeostasis under various stress conditions .

In Ralstonia solanacearum, a significant plant pathogen causing bacterial wilt disease across numerous host plants, membrane integrity is crucial for virulence and survival within the plant's xylem vessels. The bacterium thrives in water-transporting xylem vessels, which are relatively nutrient-poor environments, making efficient protein quality control essential for bacterial persistence .

The study of HtpX proteases contributes to our understanding of how bacteria maintain membrane integrity under environmental stress conditions, which is particularly relevant for pathogenic bacteria like R. solanacearum that must adapt to the challenging environment of plant vascular systems.

How does the recombinant Ralstonia solanacearum Protease HtpX differ from native HtpX?

Recombinant Ralstonia solanacearum Protease HtpX is produced through genetic engineering techniques and typically includes tag sequences to facilitate purification and detection. The recombinant version is expressed in heterologous systems (often E. coli) rather than in its native bacterial context.

Key differences include:

FeatureNative HtpXRecombinant HtpX
Expression systemR. solanacearumHeterologous expression systems (typically E. coli)
Purification tagsNoneMay contain His-tags, Myc-tags, or other fusion partners
Membrane integrationIntegrated into bacterial membraneMay be isolated from membrane or refolded
Post-translational modificationsNative bacterial modificationsMay lack native modifications depending on expression system
ActivityNatural activity in bacterial contextActivity may be affected by recombinant production process

For research applications, the tag information for recombinant HtpX is determined during the production process, and the protein is typically supplied in a Tris-based buffer with 50% glycerol to optimize stability .

What are the recommended protocols for assessing HtpX protease activity in vitro?

When assessing HtpX protease activity in vitro, researchers should consider the following methodological approach:

  • Buffer and Reaction Conditions:

    • Use a Tris-based buffer (typically 50 mM Tris-HCl, pH 7.5-8.0)

    • Include divalent metal ions (particularly Zn²⁺, as HtpX is a zinc metalloproteinase)

    • Optimal temperature: 30-37°C for most assays

    • Monitor activity across a pH range of 6.5-8.5 to determine pH optima

  • Substrate Selection:

    • Synthetic peptides containing known cleavage sites

    • Fluorogenic peptide substrates for quantitative measurement

    • Model membrane protein substrates that mimic physiological targets

  • Detection Methods:

    • Fluorescence-based assays using FRET peptides

    • SDS-PAGE analysis of substrate cleavage products

    • Western blotting to detect specific cleavage fragments

    • Mass spectrometry to identify precise cleavage sites

  • Controls and Validation:

    • Include enzyme-free negative controls

    • Use known metalloprotease inhibitors (such as EDTA) as functional controls

    • Compare wild-type HtpX activity to catalytic site mutants

    • Verify zinc dependency by metal chelation and reconstitution experiments

A semiquantitative approach similar to that developed for E. coli HtpX can be adapted for R. solanacearum HtpX, which involves constructing model substrates and monitoring their cleavage patterns under various conditions .

How can I establish an in vivo assay system for Ralstonia solanacearum HtpX protease activity?

To establish an in vivo assay system for R. solanacearum HtpX protease activity, researchers can adapt the methodology developed for E. coli HtpX, which involves creating model substrates that can be monitored within living bacterial cells. The following steps are recommended:

  • Design and Construction of Model Substrates:

    • Develop fusion proteins containing potential cleavage sites

    • Include reporter tags (such as GFP or epitope tags) on both N- and C-terminal ends

    • Ensure proper membrane localization through transmembrane segments

  • Expression System Setup:

    • Use an inducible expression system for controlled production of both HtpX and substrate

    • Consider plasmid compatibility when co-expressing multiple constructs

    • Optimize expression levels to prevent artifacts from overexpression

  • Detection and Quantification Methods:

    • Western blotting using antibodies against reporter tags

    • Fluorescence measurements for GFP-based reporters

    • Immunoprecipitation to isolate processed fragments

    • Pulse-chase experiments to monitor substrate turnover kinetics

  • Validation with Controls:

    • Compare wild-type HtpX with catalytically inactive mutants

    • Test substrate specificity using modified cleavage sites

    • Verify membrane localization of both protease and substrate

    • Assess the impact of various stress conditions on activity

This approach can be semiquantitative and provide valuable insights into the differential protease activities of HtpX variants with mutations in conserved regions .

What are the optimal storage and handling conditions for recombinant HtpX?

For optimal stability and activity of recombinant Ralstonia solanacearum Protease HtpX, adhere to the following storage and handling guidelines:

  • Storage Temperature:

    • Store at -20°C for routine use

    • For extended storage, maintain at -80°C

    • Avoid repeated freeze-thaw cycles

  • Buffer Composition:

    • Tris-based buffer with pH 7.5-8.0

    • Include 50% glycerol as a cryoprotectant

    • Consider adding reducing agents (e.g., DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Working Conditions:

    • Prepare working aliquots to minimize freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • Keep on ice during experiments

  • Stability Considerations:

    • Monitor protein activity periodically to ensure functionality

    • Avoid exposure to extreme pH or temperature conditions

    • Protect from proteolytic degradation by including protease inhibitors when necessary

These guidelines ensure maintenance of structural integrity and enzymatic activity during storage and experimental procedures.

How can I identify potential physiological substrates of R. solanacearum HtpX?

Identifying physiological substrates of R. solanacearum HtpX requires a multi-faceted approach combining proteomics, genetics, and biochemical validation:

  • Comparative Proteomics:

    • Perform quantitative proteomics comparing wild-type R. solanacearum with htpX deletion mutants

    • Focus on membrane protein fractions using specialized extraction techniques

    • Analyze protein accumulation patterns under various stress conditions

    • Apply SILAC or TMT labeling for precise quantification of protein level changes

  • Substrate Trapping Approaches:

    • Generate catalytically inactive HtpX variants that bind but do not cleave substrates

    • Use crosslinking coupled with mass spectrometry to identify interaction partners

    • Perform co-immunoprecipitation experiments to isolate substrate complexes

  • Bioinformatic Prediction:

    • Analyze membrane proteomes for motifs similar to known HtpX cleavage sites

    • Screen for proteins that accumulate when HtpX is inactive

    • Examine co-expression patterns of HtpX with potential substrate candidates

  • Validation Methods:

    • Test direct cleavage of candidate substrates using purified components

    • Monitor substrate stability in vivo with and without functional HtpX

    • Determine specific cleavage sites using mass spectrometry

    • Confirm biological relevance by assessing phenotypic effects of substrate processing

This systematic approach can help identify the membrane proteins that are physiological targets of HtpX in the context of R. solanacearum biology and pathogenesis .

What structural features are essential for HtpX catalytic activity, and how can they be experimentally verified?

The catalytic activity of HtpX depends on several critical structural features that can be experimentally verified through targeted approaches:

  • Essential Catalytic Domains:

    • The zinc-binding motif HEXXH, characteristic of M48 metalloproteases

    • Conserved glutamate residue acting as the third zinc ligand

    • Hydrophobic regions that facilitate membrane integration and substrate recognition

  • Experimental Verification Methods:

    • Site-directed mutagenesis: Systematically mutate conserved residues and assess impact on activity

    • Metal binding assays: Measure zinc binding affinity using isothermal titration calorimetry or zinc-specific fluorescent probes

    • Structural analysis: Apply techniques such as cryo-EM or X-ray crystallography with detergent-solubilized or nanodisk-embedded HtpX

    • Membrane topology mapping: Use reporter fusions or cysteine accessibility methods to determine transmembrane segment orientation

  • Activity Correlation Experiments:

    Mutation TypeExpected OutcomeExperimental Readout
    HEXXH → AAXXHLoss of zinc binding and catalytic activityNo substrate cleavage
    Conserved glutamate → alanineDisrupted zinc coordinationReduced metal binding and activity
    Transmembrane domainsAltered membrane integrationChanged localization and substrate accessibility
    C-terminal domainAffected substrate recognitionSubstrate-specific activity changes
  • Homology-Based Predictions:

    • Compare with better-characterized HtpX homologs from model organisms like E. coli

    • Apply computational modeling based on related zinc metalloprotease structures

    • Validate predictions through targeted experimental approaches

These approaches allow for comprehensive characterization of the structural determinants of HtpX activity and provide insights into potential inhibitor design for pathogen-targeted interventions.

How does HtpX function relate to R. solanacearum virulence in plant hosts?

The relationship between HtpX function and R. solanacearum virulence in plant hosts represents a complex area of investigation with important implications for plant pathology:

  • Membrane Protein Quality Control During Infection:

    • HtpX likely contributes to bacterial adaptation to the nutrient-poor xylem environment

    • Proper membrane protein maintenance is essential for survival under plant defense responses

    • The protease may help manage protein damage caused by plant-derived antimicrobial compounds

  • Integration with Virulence Mechanisms:

    • HtpX could influence the stability and function of membrane-associated virulence factors

    • Type III secretion system components may require quality control for optimal function

    • Bacterial communication systems (quorum sensing) often involve membrane-bound receptors that might be HtpX substrates

  • Experimental Approaches to Establish Connections:

    • Generate htpX deletion mutants and assess virulence in various plant hosts

    • Perform transcriptome analysis of htpX mutants during plant infection

    • Monitor membrane protein composition changes in wild-type versus htpX mutants during infection

    • Test sensitivity of htpX mutants to plant defense compounds

  • Potential Impact on Bacterial Physiology During Infection:

    • HtpX may be involved in managing stress responses when bacteria colonize xylem vessels

    • The protease could help maintain membrane integrity when bacteria face water potential fluctuations in plants

    • Adaptation to changing nutritional conditions during infection progression might require HtpX-mediated protein turnover

Understanding these relationships could eventually lead to novel control strategies targeting bacterial membrane protein quality control systems to attenuate virulence.

What are common challenges in working with membrane proteases like HtpX, and how can they be overcome?

Working with membrane proteases such as HtpX presents several technical challenges that require specific strategies to overcome:

  • Solubility and Purification Issues:

    • Challenge: Membrane proteins are inherently hydrophobic and difficult to solubilize.

    • Solutions:

      • Use mild detergents (DDM, CHAPS, or digitonin) for extraction

      • Consider nanodiscs or liposomes for maintaining native-like membrane environment

      • Employ specialized affinity tags designed for membrane protein purification

      • Implement on-column detergent exchange during purification

  • Maintaining Catalytic Activity:

    • Challenge: Loss of activity during purification process or storage.

    • Solutions:

      • Include appropriate metal ions (particularly zinc) in buffers

      • Optimize detergent concentration to balance solubilization with activity preservation

      • Consider using membrane fractions for activity assays rather than fully purified protein

      • Apply rapid purification protocols to minimize time outside native environment

  • Substrate Accessibility:

    • Challenge: Recreating physiologically relevant substrate presentation.

    • Solutions:

      • Reconstitute HtpX in proteoliposomes with substrate proteins

      • Design model substrates with appropriate membrane-targeting signals

      • Consider cell-free translation systems with supplied membranes

  • Activity Detection:

    • Challenge: Low turnover rates or difficulties in detecting cleavage products.

    • Solutions:

      • Employ highly sensitive fluorogenic substrates

      • Use epitope-tagged substrates for immunological detection

      • Implement mass spectrometry for precise identification of cleavage products

      • Develop in vivo reporter systems as demonstrated for E. coli HtpX

These methodological adaptations can significantly improve success rates when working with challenging membrane proteases like HtpX.

How can I distinguish between specific HtpX-mediated proteolysis and non-specific degradation in my experiments?

Distinguishing between specific HtpX-mediated proteolysis and non-specific degradation requires careful experimental design and appropriate controls:

  • Catalytic Site Mutants:

    • Generate HtpX variants with mutations in the catalytic HEXXH motif

    • Compare proteolytic patterns between wild-type and catalytically inactive mutants

    • Specific HtpX-mediated cleavage will be absent in catalytic mutants while non-specific degradation will persist

  • Substrate Specificity Analysis:

    • Design substrate variants with mutations at potential cleavage sites

    • Test multiple substrate candidates with varying sequences

    • Specific proteolysis will show sequence selectivity that non-specific degradation lacks

  • Inhibitor Profiles:

    • Use class-specific protease inhibitors:

      • Metalloprotease inhibitors (EDTA, 1,10-phenanthroline) should block HtpX

      • Serine protease inhibitors (PMSF) should not affect HtpX activity

      • Broad-spectrum inhibitor cocktails can be used to control for contaminating proteases

    • Develop a characteristic inhibition profile for authentic HtpX activity

  • Time Course and Concentration Dependence:

    • Specific proteolysis should show enzyme concentration dependence

    • Establish kinetic parameters (Km, Vmax) for putative substrates

    • Non-specific degradation often lacks the orderly progression of specific proteolysis

  • Cleavage Site Mapping:

    • Identify precise cleavage sites using N-terminal sequencing or mass spectrometry

    • Specific proteolysis typically generates consistent fragments

    • Non-specific degradation produces variable or ladder-like fragment patterns

Implementing these controls systematically helps establish the specificity of observed proteolytic events and validates HtpX as the responsible enzyme.

What experimental approaches can determine the membrane topology and subcellular localization of HtpX in R. solanacearum?

Determining the membrane topology and subcellular localization of HtpX in R. solanacearum requires specialized techniques that address the challenges of membrane protein analysis:

  • Membrane Topology Mapping:

    • Reporter Fusion Approach:

      • Generate fusions of topology-determining domains with reporters like PhoA (active in periplasm) or GFP (active in cytoplasm)

      • Systematically create fusions at different positions in the HtpX sequence

      • Analyze reporter activity to determine cytoplasmic versus periplasmic orientation

    • Cysteine Accessibility Method:

      • Introduce cysteine residues at various positions throughout HtpX

      • Treat intact cells with membrane-impermeable sulfhydryl reagents

      • Analyze modification patterns to determine exposed regions

  • Subcellular Localization:

    • Immunofluorescence Microscopy:

      • Generate antibodies against HtpX or use epitope-tagged versions

      • Perform immunolabeling with appropriate membrane permeabilization

      • Co-localize with known membrane compartment markers

    • Subcellular Fractionation:

      • Separate cytoplasmic, inner membrane, and outer membrane fractions

      • Analyze HtpX distribution using Western blotting

      • Include controls for each cellular compartment (e.g., known inner membrane proteins)

  • Protease Protection Assays:

    • Treat membrane vesicles with proteases with or without membrane permeabilization

    • Analyze proteolytic fragments to determine exposed domains

    • Compare experimental results with computational topology predictions

  • Functional Domain Mapping:

    • Create chimeric proteins with domains from better-characterized homologs

    • Assess functionality to determine critical regions for membrane integration

    • Use deletion analysis to identify essential topology-determining segments

These approaches provide complementary information that, when combined, can establish a detailed model of HtpX membrane topology and subcellular localization in R. solanacearum, which is essential for understanding its functional mechanisms .

How might HtpX proteases be exploited as targets for novel antimicrobial strategies against R. solanacearum?

HtpX proteases represent promising targets for developing novel antimicrobial strategies against R. solanacearum, with several research avenues worth exploring:

  • Inhibitor Development Approaches:

    • Structure-based design of specific inhibitors targeting the HtpX catalytic site

    • High-throughput screening of chemical libraries for compounds that disrupt HtpX function

    • Peptide-based inhibitors mimicking substrate recognition sequences but resistant to cleavage

    • Natural product screening for molecules that selectively inhibit bacterial membrane proteases

  • Target Validation Strategies:

    • Confirm essentiality of HtpX under infection-relevant conditions

    • Identify synergistic effects when combining HtpX inhibition with other control methods

    • Demonstrate reduced virulence in planta when HtpX function is compromised

    • Assess potential for resistance development through appropriate evolution experiments

  • Delivery System Development:

    • Design plant-compatible formulations for soil application

    • Explore systemic acquired resistance inducers that might be co-applied with HtpX inhibitors

    • Investigate transgenic approaches for in planta expression of HtpX-targeting molecules

    • Develop carrier systems that can access bacteria within plant vascular systems

  • Potential Advantages of HtpX as a Target:

    • Membrane proteases often have distinct structural features from their eukaryotic counterparts

    • Disruption of membrane protein quality control may sensitize bacteria to plant defense mechanisms

    • HtpX inhibition could potentially destabilize other virulence factors through indirect effects

    • Targeting membrane homeostasis may have broader efficacy across different growth conditions

This research direction holds promise for developing sustainable control strategies for bacterial wilt disease, which causes significant agricultural losses worldwide.

What comparative analyses between HtpX homologs in different bacterial species might reveal about their evolutionary and functional significance?

Comparative analyses of HtpX homologs across bacterial species offer valuable insights into evolutionary adaptations and functional specialization:

  • Phylogenetic Distribution and Conservation:

    • Compare HtpX sequences from diverse bacterial phyla

    • Identify core conserved domains versus variable regions

    • Correlate sequence conservation with lifestyle (pathogenic vs. non-pathogenic)

    • Map evolutionary relationships between HtpX variants in plant, animal, and environmental bacteria

  • Structure-Function Relationship Analysis:

    • Compare transmembrane topology predictions across homologs

    • Identify differentially conserved catalytic residues

    • Analyze substrate-binding domain variations

    • Assess conservation of regulatory elements and interaction motifs

  • Experimental Approaches for Functional Comparison:

    • Cross-species complementation assays to test functional conservation

    • Heterologous expression studies to identify species-specific activities

    • Chimeric protein construction to map functional domains

    • Comparative substrate specificity profiling

  • Correlation with Ecological Niches:

    Bacterial GroupEnvironmentExpected HtpX Adaptations
    Plant pathogens (R. solanacearum)Plant xylem vesselsAdaptations for function in plant defense molecule-rich environments
    Soil bacteriaDiverse soil conditionsBroader substrate range for varied environmental stresses
    Animal pathogensHost-associated nichesSpecialization for animal host defense evasion
    ExtremophilesExtreme pH, temperature, etc.Structural adaptations for stability under extreme conditions
  • Genomic Context Analysis:

    • Examine conservation of genomic neighborhoods around htpX genes

    • Identify co-evolved gene clusters that might function with HtpX

    • Analyze regulatory elements governing htpX expression in different species

These comparative analyses can reveal how HtpX proteases have evolved to meet specific challenges in different ecological niches and provide insights into the functional plasticity of this important protease family.

How does the function of HtpX integrate with other stress response pathways in R. solanacearum during plant infection?

The integration of HtpX function with stress response pathways in R. solanacearum during plant infection represents a complex regulatory network that merits detailed investigation:

  • Stress Response Network Interactions:

    • Examine transcriptional regulation of htpX under various stress conditions relevant to plant infection

    • Map potential overlaps between HtpX substrates and other stress response pathway components

    • Investigate interactions between HtpX and other quality control systems (chaperones, other proteases)

    • Analyze phenotypes of double mutants lacking both htpX and other stress response genes

  • Plant-Induced Stress Management:

    • Study HtpX activity changes in response to plant defense molecules

    • Assess membrane protein damage patterns during exposure to antimicrobial plant compounds

    • Investigate potential protective roles of HtpX against reactive oxygen species generated during infection

    • Determine if HtpX contributes to adaptation to the ionic and osmotic conditions of xylem sap

  • Signaling Pathway Intersections:

    • Explore connections with quorum sensing systems that regulate virulence

    • Investigate potential regulation by two-component signaling systems monitoring environmental conditions

    • Analyze links to global stress regulators such as PhcA, which controls multiple virulence factors

    • Examine if HtpX function affects Type III secretion system assembly or activity

  • Metabolic Adaptation Coordination:

    • Study how HtpX function correlates with metabolic shifts during infection

    • Investigate connections with nutrient acquisition systems needed in the xylem environment

    • Assess potential roles in maintaining transporters required for carbon source utilization in planta

    • Explore links to siderophore production and iron acquisition systems essential for virulence

Understanding these integrated networks could reveal critical vulnerabilities in R. solanacearum's adaptation to the plant environment that might be exploited for disease management.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.