Recombinant Ralstonia solanacearum Putative tyrosine-protein kinase epsB (epsB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
epsB; Putative tyrosine-protein kinase EpsB; EPS I polysaccharide export protein EpsB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-750
Protein Length
full length protein
Species
Ralstonia solanacearum (Pseudomonas solanacearum)
Target Names
epsB
Target Protein Sequence
MTQNLPQPPAVNAPENELDLVRYLDVLVANRWLIAGIAAAVMLLGAAYAFLARPVYEADI MVQVEDNPNSAKSLLGDVSSLFDVKTDANAEIEILRSRMVVGKAVDNLHLYITAKPRYFP LIGAWISSRATRLSEPGLFGLGGYVWGTESIDVDGFDVPEALEGQPFKLIVLGNGRYRLE NKSLDAPIEGVVGEPLEAKQSIGTIQLQVNNLTAKAGATFELERDSRLKTMEMLQDKLKI AEKGKQSGIIGASLDGTNPALTAAIMNQIATEYVAQNIKRKAEEAERSLVFLDGLLPQLK LELERAEMKYNEMRNLRGTFDLSEEGKAFLQESVTVETSLQELKQKRAELLTRFTSSHPG VQAIDQQISVMSGKVNSMTRRLKSLPNIEQDTVRLMRDVQVDNELYVSLLNDMQQLKLVK AGKVGNVRLVDGAAVPEEPVKPKKLTVTPLAGVLGVVLGVMAAFVRNALFGGITDPQDIE EHTGLSVYATVPLSDTQVDLSGQLTTRKRGQYLLARRVPDDPSIEALRSLRTALQFAMQD AGNNLVVLTGPTPGVGKSFVSANLAAVIATGGKRVLLIDADMRKGYLHQYFGKDRKPGLL DLLAGNRSIEQVVHREVVPGLDFIATGLFPHNPSELLLNPRMVELMDTFRSQYDLVLVDT PPVLAVADTAILAARAGLVLLVTRFERSTLGEIRETIKQLQHANVDVRGVVFNALDPNTY RYGYGSRYGRYRYVQYGYTSNSKPPEAESA
Uniprot No.

Target Background

Function
This protein is likely involved in the polymerization and/or export of exopolysaccharide EPS I, a virulence factor. It may participate in an ATP-dependent process within the EPS I production pathway, potentially exporting trimeric repeat units across the inner membrane or facilitating their polymerization.
Protein Families
Etk/wzc family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is EpsB and what is its role in Ralstonia solanacearum?

EpsB is a putative tyrosine-protein kinase in Ralstonia solanacearum that plays a critical role in exopolysaccharide (EPS) production. It belongs to a family of bacterial tyrosine kinases (BY kinases) that are membrane-associated and involved in virulence mechanisms. Research demonstrates that EpsB is essential for the synthesis of the major exopolysaccharide (EPS I), which is a primary virulence factor in R. solanacearum pathogenesis .

Methodologically, the function of EpsB has been established through gene deletion studies that show ΔepsB mutants exhibit:

  • Dramatically reduced EPS production

  • Reduced cellulase activity

  • Significantly attenuated pathogenicity on host plants

  • Altered transcription of numerous genes involved in virulence

In the bacterial life cycle, EpsB contributes to quorum sensing (QS) regulation, with QS-dependently produced EPS I being associated with a feedback loop of QS in R. solanacearum .

How is the function of EpsB experimentally determined in R. solanacearum?

The function of EpsB is determined through several complementary experimental approaches:

  • Gene deletion studies: Creating ΔepsB mutants through techniques such as markerless gene deletion methods (e.g., exploiting natural transformation competence and FLP/FRT systems)

  • Phenotypic assays:

    • Quantification of bacterial extracellular polysaccharides by measuring total sugar content

    • Cellulase activity plate assays

    • Virulence assays on host plants like eggplants

    • Analysis of bacterial morphology on specific media (e.g., CTG medium)

  • Transcriptome analysis: RNA sequencing technology to compare expression profiles between wild-type and ΔepsB mutants, revealing that deletion of epsB affects the expression of 477 genes positively and 198 genes negatively

  • Complementation experiments: Reintroducing the functional epsB gene into ΔepsB mutants to confirm the role of EpsB in the observed phenotypes

These methodological approaches collectively provide strong evidence for EpsB's role in EPS production and virulence regulation.

What is the relationship between EpsB and exopolysaccharide production in R. solanacearum?

EpsB functions as a critical regulatory component in the biosynthesis pathway of EPS I in R. solanacearum. The relationship can be characterized as follows:

  • Regulatory role: EpsB, as a bacterial tyrosine kinase, regulates EPS I production through phosphorylation-dependent mechanisms

  • Quantitative impact: Deletion of epsB results in significantly reduced EPS production as measured by total sugar content assays (p-value < 0.001)

  • Pathway integration: EpsB functions within a complex regulatory network that includes quorum sensing components (PhcA/PhcB system) that control EPS biosynthesis

  • Functional homology: EpsB shows functional similarity to other bacterial tyrosine kinases such as Etk in Escherichia coli, AmsA in Erwinia amylovora, and BtkB in Myxococcus xanthus, which are all involved in EPS production

The experimental evidence supporting this relationship comes from comparative analyses between wild-type and ΔepsB mutant strains, which consistently show that EpsB-deficient strains produce significantly less EPS and consequently display reduced virulence .

How does the molecular structure of EpsB contribute to its function as a bacterial tyrosine kinase?

The molecular structure of EpsB in R. solanacearum reveals several key features that contribute to its tyrosine kinase activity:

  • Domain organization:

    • N-terminal transmembrane domain

    • C-terminal cytoplasmic catalytic domain containing the ATP-binding site

    • Walker A and B motifs typical of P-loop NTPases

  • Nucleotide-binding motif:
    The AXXXXGKT sequence (amino acids 418-425) is critical for ATP binding and subsequent phosphorylation events

  • Tyrosine phosphorylation sites:
    Multiple tyrosine residues in the C-terminal region serve as autophosphorylation sites, similar to the pattern observed in other bacterial tyrosine kinases like Etk in E. coli

  • Sequence comparison:
    Alignment with other bacterial tyrosine kinases shows EpsB shares approximately 20-40% similarity with the catalytic domains of other BY kinases involved in EPS regulation

The full-length EpsB protein (750 amino acids) contains the sequence necessary for both membrane anchoring and enzymatic function . Recombinant expression with His-tags at the N-terminus has enabled biochemical characterization while maintaining enzymatic activity .

Researchers can investigate the structure-function relationship through site-directed mutagenesis of key residues in the nucleotide-binding motif and potential phosphorylation sites, followed by kinase activity assays using synthetic substrates like poly(Glu:Tyr) .

What is the role of EpsB in the quorum sensing system of R. solanacearum and how does it affect virulence gene expression?

EpsB plays a sophisticated role in the quorum sensing (QS) regulatory network of R. solanacearum through a complex feedback mechanism:

  • QS-EpsB regulatory pathway:

    • R. solanacearum produces methyl 3-hydroxymyristate as a QS signal

    • QS-activated LysR-type transcriptional regulator PhcA induces EPS I production

    • EpsB is required for EPS I production

    • EPS I production then feeds back to regulate QS-dependent genes

  • Global transcriptional impact:
    RNA-seq analysis revealed that deletion of epsB affects:

    • 97.2% of positively QS-regulated genes (decreased expression)

    • 98.0% of negatively QS-regulated genes (increased expression)

    • This indicates EpsB-dependent EPS production is integral to QS feedback

  • Specific virulence factors affected:

    Virulence FactorFunctionImpact of epsB Deletion
    Ralfuranones (A, B, J, K, L)Secondary metabolitesSignificantly reduced production
    Plant cell wall degradation enzymes (cbhA, egl, pme)Tissue macerationDecreased expression
    Type III secretion system effectorsHost manipulationAltered expression
    Type VI secretion systemBacterial competitionAltered expression
    CellulasePlant cell wall degradationReduced activity
    Swimming motilityColonizationEnhanced (QS typically suppresses)
  • Feedback mechanism:
    The deficiency in EPS I production in ΔepsB mutants does not affect expression of phcA and phcB (core QS regulators), suggesting EpsB functions downstream of these regulators but participates in feedback regulation of QS-dependent genes .

The methodological approach to establish these relationships involves comparative transcriptomics, quantitative RT-PCR for specific genes, metabolite analysis, and phenotypic assays between wild-type and ΔepsB mutant strains .

How can Design of Experiments (DoE) be applied to optimize recombinant EpsB protein expression and purification?

Applying Design of Experiments (DoE) methodologies for optimizing recombinant EpsB protein expression and purification can significantly enhance yield and activity while reducing experimental time and resources:

  • Factorial experimental design for expression optimization:

    FactorLow LevelHigh LevelPotential Impact
    IPTG concentration0.1 mM1.0 mMInduction strength
    Temperature post-induction16°C30°CProtein folding
    Induction time4 hours16 hoursProtein accumulation
    Media compositionLBTBBiomass yield
    E. coli strainBL21(DE3)Rosetta(DE3)Codon bias adaptation

    Using a fractional factorial design can reduce the number of experiments while still capturing interaction effects between factors. Response variables should include soluble protein yield and enzymatic activity .

  • Response surface methodology (RSM) for purification optimization:

    After initial screening, RSM can be used for fine-tuning purification conditions:

    • Imidazole concentration in binding/washing/elution buffers

    • pH and salt concentration effects on protein stability

    • Addition of stabilizing agents (glycerol, trehalose) at optimal concentrations

    • Refolding conditions if inclusion bodies are formed

  • Analysis approach:

    Statistical software can generate contour plots and response surfaces to visualize optimal conditions. For example, the interaction between temperature and IPTG concentration might reveal that lower temperatures with moderate IPTG levels maximize soluble EpsB yield .

  • Validation experiments:

    The predicted optimal conditions must be validated experimentally by performing triplicate experiments at optimized settings and comparing yields to baseline conditions. Success criteria should include:

    • Protein purity (>90% by SDS-PAGE)

    • Yield (mg protein per liter of culture)

    • Enzymatic activity (autophosphorylation and substrate phosphorylation capacity)

    • Stability during storage

This methodological approach allows researchers to systematically identify optimal conditions while accounting for complex interactions between variables, significantly improving the efficiency of recombinant EpsB production compared to traditional one-factor-at-a-time approaches .

What are the recommended methods for measuring EpsB kinase activity in vitro?

Measuring EpsB kinase activity in vitro requires specific biochemical assays that can detect phosphorylation events. Based on established protocols for bacterial tyrosine kinases, the following methodological approaches are recommended:

  • Autophosphorylation assay:

    • Purified recombinant EpsB (5-10 μg)

    • Reaction buffer: 50 mM Tris-HCl (pH 7.5), 10 mM MgCl₂, 1 mM DTT

    • ATP source: 10 μCi [γ-³²P]ATP or 100 μM cold ATP

    • Incubation: 30 minutes at 30°C

    • Detection: Autoradiography (for radioactive ATP) or anti-phosphotyrosine antibodies (for cold ATP)

    • Controls: Heat-inactivated EpsB, kinase-dead mutant (e.g., K419A in ATP-binding motif)

  • Exogenous substrate phosphorylation:

    • Synthetic substrates: poly(Glu:Tyr) (4:1) at 0.5-1 mg/ml

    • Potential physiological substrates: other proteins involved in EPS biosynthesis

    • Detection: As above, plus specific antibodies against phosphorylated substrate

    • Quantification: Densitometric analysis or scintillation counting

  • Phosphatase-coupled assays:

    • Treating phosphorylated EpsB with specific tyrosine phosphatases (e.g., YopH)

    • Monitoring dephosphorylation to confirm tyrosine-specific phosphorylation

  • Kinetics analysis:

    • Varying ATP concentrations (10-500 μM)

    • Determining Km and Vmax values

    • Examining effects of divalent cations (Mg²⁺, Mn²⁺) on activity

    • Testing inhibitors to characterize active site properties

  • Phosphoamino acid analysis:

    • Acid hydrolysis of phosphorylated proteins

    • Thin-layer chromatography or high-performance liquid chromatography

    • Comparison with phosphoamino acid standards to confirm phosphorylation occurs on tyrosine residues

When reporting results, researchers should include both qualitative data (images of gels/blots) and quantitative measurements (relative or absolute phosphorylation levels normalized to protein amount) to facilitate comparison between experimental conditions and across different studies.

What genetic manipulation techniques are most effective for creating epsB mutants in R. solanacearum?

Several genetic manipulation techniques have been developed for creating epsB mutants in R. solanacearum, with varying efficiency and advantages depending on research objectives:

  • Markerless gene deletion using natural transformation:

    This approach exploits R. solanacearum's natural competence and has proven highly effective:

    • Method: Generate fusion DNA fragments containing:

      • Upstream flanking region of epsB (~1 kb)

      • Selectable marker (e.g., gentamicin resistance gene)

      • Downstream flanking region of epsB (~1 kb)

      • FRT (Flippase Recognition Target) sites flanking the marker

    • Steps:

      1. Transform R. solanacearum with the fusion fragment

      2. Select transformants on gentamicin-containing media

      3. Verify integration by PCR

      4. Introduce FLP recombinase via a second transformation

      5. Select for marker loss on appropriate media

      6. Verify markerless deletion by PCR and sequencing

    • Advantages: Creates clean deletions without polar effects on downstream genes; no antibiotic marker remains in the final strain

  • Homologous recombination using suicide vectors:

    • Method: Clone epsB flanking regions into a suicide vector (e.g., pK18mobsacB)

    • Delivery: Conjugation via triparental mating with helper strain

    • Selection: Two-step selection using antibiotic resistance and sucrose sensitivity/resistance

    • Verification: PCR and sequencing to confirm precise deletion

  • CRISPR-Cas9 system for R. solanacearum:

    Though not specifically mentioned in the provided references for epsB, CRISPR-Cas9 systems have been adapted for Ralstonia species:

    • Components: Cas9 expression vector, guide RNA targeting epsB, homology-directed repair template

    • Advantages: Potentially higher efficiency; can create point mutations for structure-function studies

  • Comparison of success rates:

    MethodSuccess RateTime RequiredSpecial Considerations
    Natural transformation with FLP/FRT>90% for first integration; ~50% for marker removal7-10 daysRequires natural competence
    Suicide vector/homologous recombination60-80%10-14 daysMay have higher false positives
    CRISPR-Cas970-90% (estimated)5-7 daysRequires optimization of guide RNAs
  • Validation of mutants:

    Regardless of the method used, comprehensive validation is essential:

    • PCR verification with primers spanning deletion junctions

    • Sequencing to confirm precise deletion

    • Phenotypic assays (EPS production, colony morphology)

    • Complementation with wild-type epsB to confirm phenotype is due to epsB deletion

    • Transcriptome analysis to confirm expected changes in gene expression

The choice of method should consider the specific strain of R. solanacearum being used (as transformation efficiency varies among strains) and the downstream experimental applications.

How can researchers effectively quantify EPS production in wild-type versus epsB mutant R. solanacearum strains?

Accurate quantification of EPS production is critical for evaluating the role of EpsB in R. solanacearum. Multiple complementary methods provide comprehensive assessment of EPS differences between wild-type and epsB mutant strains:

  • Total sugar content determination:

    • Method: Phenol-sulfuric acid assay

      1. Collect bacterial supernatant (typically from 48-72h cultures)

      2. Remove cells by centrifugation (8,000×g, 10 min)

      3. Add phenol (5%) and concentrated sulfuric acid

      4. Measure absorbance at 490nm

    • Quantification: Generate standard curve using glucose (0-100 μg/ml)

    • Data presentation: Express as μg sugar equivalent per mg bacterial protein or per CFU

    • Statistical analysis: Typically shows >80% reduction in ΔepsB mutants (p<0.001)

  • Colony morphology assessment:

    • Method: Streak bacteria on EPS-inducing media (e.g., CTG medium)

    • Observation: Wild-type forms fluidal, mucoid colonies; ΔepsB forms dry, non-mucoid colonies

    • Documentation: Photograph colonies after 48-72h incubation

    • Quantification: Colony spreading diameter measurements

  • EPS precipitation and purification:

    • Method:

      1. Precipitate EPS from culture supernatant using ethanol (3 volumes)

      2. Collect precipitate by centrifugation

      3. Dialyze against distilled water

      4. Lyophilize and weigh

    • Quantification: Dry weight of purified EPS per liter of culture

    • Advantage: Provides purified EPS for further compositional analysis

  • Molecular composition analysis:

    • Methods:

      • High-performance anion-exchange chromatography (HPAEC)

      • Gas chromatography-mass spectrometry (GC-MS) after hydrolysis

    • Data: Monosaccharide composition profiles

    • Advantage: Can detect qualitative changes in EPS composition that might occur in epsB mutants

  • Calcofluor binding assay:

    • Method: Mix bacterial cultures with Calcofluor white

    • Observation: Reduced fluorescence in ΔepsB mutants

    • Quantification: Fluorescence measurement (excitation 365nm, emission 435nm)

    • Advantage: High-throughput method suitable for screening multiple strains

  • Gene expression analysis:

    • Method: qRT-PCR for EPS biosynthesis genes

    • Targets: eps operon genes (excluding epsB)

    • Reference genes: rpoD, gyrB

    • Data presentation: Relative expression ratios between wild-type and mutant strains

    • Insight: Distinguishes between direct effects on EPS production versus regulatory effects on biosynthetic gene expression

A comprehensive approach would employ at least three complementary methods (e.g., total sugar content, colony morphology, and gene expression) to provide robust evidence for the impact of EpsB on EPS production. Statistical analysis should include appropriate replicates (minimum n=3) and statistical tests (typically t-test or ANOVA with post-hoc tests).

How does EpsB in R. solanacearum compare functionally to tyrosine kinases in other bacterial plant pathogens?

EpsB in R. solanacearum shares functional similarities but also exhibits distinct characteristics when compared to tyrosine kinases in other bacterial plant pathogens:

  • Comparative analysis with homologous proteins:

    Bacterial SpeciesProteinSimilarity to EpsBRole in PathogenicityFunctional Differences
    Erwinia amylovoraAmsA35-40% amino acid similarityEPS (amylovoran) production required for virulenceRegulatory targets may differ based on EPS composition
    Escherichia coli (pathogenic)Etk20-40% similarity in catalytic domainCapsular polysaccharide group 4 productionAdditional roles in antibiotic resistance
    Klebsiella pneumoniaeOrf6Functional homologyCapsule production for host colonizationDifferent host specificity and infection strategies
    Xanthomonas campestrisGumD/GumCFunctional analogy (different structure)Xanthan gum productionDifferent enzymatic mechanism
    Pseudomonas syringaeSimilar PTKsLimited informationVarious virulence factorsMay integrate with different regulatory networks
  • Conservation of functional domains:

    • Nucleotide-binding motif: The AXXXXGKT sequence is highly conserved across bacterial tyrosine kinases

    • Transmembrane topology: Most homologs contain N-terminal transmembrane domains and C-terminal catalytic domains

    • Walker A and B motifs: Conserved for ATP binding and hydrolysis functions

  • Associated regulatory components:

    Most bacterial tyrosine kinases involved in EPS production operate within a conserved genetic context:

    • Outer membrane lipoprotein: Required for proper function (ExoQ in R. meliloti, Wzc in E. coli)

    • Cognate phosphatase: Often encoded nearby (EpsP in R. solanacearum, Wzb in E. coli)

    • EPS biosynthetic genes: Typically part of a larger operon or regulon

  • Functional conservation and divergence:

    • Conserved function: Regulation of EPS/capsular polysaccharide biosynthesis

    • Divergent aspects:

      • Integration with quorum sensing systems (unique feedback mechanism in R. solanacearum)

      • Different substrate specificities reflecting the unique EPS composition of each species

      • Variable impact on other virulence mechanisms (e.g., type III secretion systems)

  • Evolutionary implications:

    The phylogenetic distribution of these tyrosine kinases suggests they represent a distinct protein family of prokaryotic membrane-associated PTKs that evolved specifically for regulating extracellular polysaccharide production and virulence in diverse bacterial pathogens .

Research approaches to further explore these relationships include comparative genomics, heterologous complementation assays (expressing EpsB in other bacterial species with mutations in their cognate tyrosine kinases), and domain-swapping experiments to identify functionally critical regions.

What is the role of EpsB-regulated EPS in plant immune responses during R. solanacearum infection?

The relationship between EpsB-regulated EPS production and plant immune responses during R. solanacearum infection reveals a complex interplay:

  • Differential host recognition and response:

    EPS produced by R. solanacearum via the EpsB-regulated pathway elicits distinct responses in resistant versus susceptible host plants:

    Host TypeResponse to Wild-type R. solanacearumResponse to ΔepsB MutantImplications
    Resistant (e.g., Hawaii7996 tomato)Rapid induction of defense genes (PR-1b, GluA); 7-fold higher PR-1b expressionSignificantly lower defense gene expressionEPS acts as a pathogen-associated molecular pattern (PAMP) recognized by resistant hosts
    Susceptible (e.g., Bonny Best tomato)Moderate defense gene inductionSimilar defense gene inductionEPS may not be specifically recognized as a PAMP
  • Defense signaling pathways activated:

    • Salicylic acid (SA) pathway: Particularly responsive to EPS in resistant hosts

    • Ethylene (ET) pathway: Also activated during infection

    • Timing differences: Resistant plants activate these pathways faster and to a greater degree than susceptible varieties

  • EPS as an elicitor rather than a suppressor:

    Contrary to the hypothesis that bacterial EPS simply cloaks the pathogen from recognition:

    • EPS does not suppress MAMP-triggered immunity

    • EPS specifically elicits defense gene expression in resistant tomato

    • The pattern of response is inconsistent with calcium sequestration as a suppression mechanism

  • ROS (Reactive Oxygen Species) production:

    • Purified EPS from wild-type R. solanacearum induces ROS production in resistant tomato

    • This suggests EPS serves as a specific elicitor of defense responses

  • Tissue-specific interactions:

    • Full spectrum defense signaling may require interaction of EPS with specific plant tissues

    • Direct introduction of purified EPS into stems elicits only a subset of defense responses compared to natural infection

  • Methodological approaches to study this interaction:

    • Comparative transcriptomics between plants infected with wild-type vs. ΔepsB mutants

    • Purified EPS infiltration assays

    • Measurement of defense gene expression using qRT-PCR

    • ROS detection using luminol-based assays or DAB staining

    • Genetic approaches using plant mutants defective in specific defense signaling pathways

This research reveals an unexpected role for EpsB-regulated EPS as a specific elicitor of plant immunity in resistant hosts rather than a virulence factor that simply evades plant defenses. This understanding could inform breeding strategies for disease resistance that specifically target EPS recognition capabilities.

How can block-randomized experimental designs improve comparative studies of wild-type and epsB mutant R. solanacearum strains?

Block-randomized experimental designs can significantly enhance the validity and statistical power of comparative studies between wild-type and epsB mutant R. solanacearum strains:

  • Principles and advantages of block randomization:

    Block randomization groups experimental units into homogeneous blocks based on factors that might influence outcomes, then randomizes treatment assignment within each block. For R. solanacearum studies, this approach:

    • Reduces experimental error by controlling for known sources of variation

    • Increases statistical power by reducing within-group variability

    • Allows for more precise estimation of treatment effects

    • Protects against confounding variables and systematic biases

  • Application to R. solanacearum virulence studies:

    Blocking FactorImplementationBenefit
    Plant genetic backgroundGroup plants of same cultivar/age in blocksControls for plant genotype effects on susceptibility
    Environmental conditionsBlock by greenhouse position or growth chamberMinimizes effects of microenvironmental variations
    Bacterial culture conditionsBlock by culture batch or growth phaseReduces variation due to bacterial physiological state
    Inoculation timeBlock by inoculation batchControls for temporal effects
    Soil/growth medium propertiesBlock by soil source or preparation batchMinimizes effects of soil microbiome or nutrient variation
  • Statistical analysis approach:

    When analyzing data from block-randomized experiments:

    • Use mixed-effects models with blocks as random effects

    • Apply Lin's regression adjustment estimator to account for blocking

    • Calculate appropriate standard errors that reflect the blocked design

    • Report both within-block and between-block variances

  • Reporting standards:

    When reporting results from block-randomized experiments:

    • Clearly describe the blocking structure and randomization procedure

    • Present both raw data and block-adjusted estimates

    • Include appropriate measure of variation (SE, CI) that account for blocking

    • Report intraclass correlation coefficients (ICC) to quantify the effectiveness of blocking

    • If block×treatment interactions are detected, report and discuss these effects

By implementing block-randomized designs, researchers can achieve more precise comparisons between wild-type and epsB mutant strains, potentially detecting smaller effect sizes with the same sample size, or maintaining statistical power with smaller experiments. This approach is particularly valuable when studying subtle phenotypic differences that might otherwise be masked by experimental noise.

What are the potential applications of EpsB inhibitors for controlling bacterial wilt disease caused by R. solanacearum?

EpsB inhibitors represent a promising strategy for controlling bacterial wilt disease, targeting a critical virulence mechanism rather than essential bacterial functions:

  • Theoretical basis for EpsB as a target:

    • EpsB is a non-essential protein for bacterial survival but critical for virulence

    • ΔepsB mutants show significantly attenuated pathogenicity

    • Targeting tyrosine kinase activity provides specificity

    • EPS production is a major virulence factor across multiple hosts

  • Potential inhibitor development strategies:

    ApproachMethodologyAdvantagesChallenges
    ATP-competitive inhibitorsStructure-based design targeting nucleotide-binding motifWell-established approach for kinase inhibitorsPotential cross-reactivity with other ATP-binding proteins
    Allosteric inhibitorsTarget regulatory interfaces between EpsB and other proteinsHigher specificityRequires detailed structural knowledge
    Peptide-based inhibitorsDesign based on substrate recognition sequencesHigh specificityDelivery challenges in planta
    Natural product screeningBioassay-guided fractionation of plant extractsMay identify novel chemical scaffoldsTime-intensive discovery process
  • Preliminary screening and validation methods:

    • Primary screens:

      • In vitro kinase activity assays with purified recombinant EpsB

      • Bacterial growth and EPS production assays

    • Secondary validation:

      • Target engagement confirmation (thermal shift assays, competition assays)

      • Effects on bacterial virulence in planta

      • Toxicity assessment on plant tissues

      • Specificity profiling against other bacterial and plant kinases

  • Delivery strategies for agricultural applications:

    • Soil drenching for preventative treatment

    • Foliar sprays with appropriate adjuvants

    • Seed treatments for systemic protection

    • Integration with existing plant protection regimes

  • Comparison with alternative control strategies:

    Control StrategyMechanismComparison to EpsB Inhibition
    AntibioticsKill bacteriaEpsB inhibitors would be less selective pressure for resistance
    Copper-based bactericidesMultiple targetsEpsB inhibitors potentially less phytotoxic
    Biological controlCompetition/antagonismEpsB inhibitors could be complementary
    Host resistancePlant recognition/defenseEpsB inhibitors could enhance partial host resistance
  • Research gaps and future directions:

    • Structural characterization of EpsB to facilitate rational inhibitor design

    • Investigation of resistance potential and mechanisms

    • Development of structure-activity relationships for lead compounds

    • Field trials under different environmental conditions

    • Integration with existing disease management strategies

The development of EpsB inhibitors represents a targeted approach that could potentially control bacterial wilt with reduced environmental impact compared to broad-spectrum bactericides. This approach aligns with the principles of integrated pest management by targeting specific virulence mechanisms rather than using lethal agents that drive antibiotic resistance.

How might advances in structural biology techniques contribute to understanding EpsB function and regulation?

Advances in structural biology can significantly enhance our understanding of EpsB function and regulation, providing critical insights for both fundamental research and applied sciences:

Structural insights gained through these advanced techniques could revolutionize our understanding of EpsB by revealing the molecular mechanisms underlying its role in EPS production and virulence regulation. This knowledge would not only advance basic science but also inform structure-based drug design efforts targeting bacterial tyrosine kinases for agricultural applications.

What emerging technologies could enhance our understanding of the interactions between EpsB, quorum sensing, and EPS production in R. solanacearum?

Emerging technologies offer unprecedented opportunities to unravel the complex relationships between EpsB, quorum sensing, and EPS production in R. solanacearum:

  • Single-cell technologies:

    • Single-cell RNA sequencing (scRNA-seq):
      Map heterogeneity in gene expression across bacterial populations during infection

    • Single-cell proteomics:
      Detect protein-level variations in EpsB expression and phosphorylation state

    • Microfluidic single-cell analysis:
      Monitor real-time responses of individual bacteria to quorum sensing signals

    • Application impact: Reveal population heterogeneity in quorum sensing response and EPS production that may be masked in bulk analyses

  • Advanced imaging techniques:

    • Super-resolution microscopy:
      Visualize EpsB localization and co-localization with other EPS biosynthetic machinery components

    • Correlative light and electron microscopy (CLEM):
      Connect molecular localization with ultrastructural context

    • Expansion microscopy:
      Physically enlarge bacterial cells to visualize protein complexes below the diffraction limit

    • Application impact: Determine if EpsB forms distinct complexes or microdomains within the bacterial membrane during active EPS production

  • Proximity-dependent labeling methods:

    • BioID or APEX2 fusion proteins:
      Identify proteins in close proximity to EpsB in living bacteria

    • PhotoCORMs (photo-controlled carbon monoxide releasing molecules):
      Trigger localized perturbation of protein function with spatial and temporal control

    • Application impact: Map the dynamic interactome of EpsB during quorum sensing activation and EPS biosynthesis

  • CRISPR-based technologies:

    • CRISPRi for fine-tuned gene repression:
      Create tunable knockdowns rather than complete knockouts

    • CRISPR-Cas13 for RNA targeting:
      Regulate gene expression post-transcriptionally

    • Base editors for precise point mutations:
      Generate specific variants of EpsB to test structure-function hypotheses

    • Application impact: Create libraries of R. solanacearum variants with precisely modified EpsB and quorum sensing components to establish mechanistic relationships

  • Biosensors and reporter systems:

    TechnologyApplicationExpected Insight
    Split fluorescent protein complementationMonitor protein-protein interactionsDirect observation of EpsB interactions with quorum sensing components
    FRET-based kinase activity sensorsReal-time monitoring of EpsB activityTemporal dynamics of kinase activation during quorum sensing
    Genetically encoded biosensors for secondary messengersTrack signaling cascadesIdentify secondary messenger involvement in EpsB regulation
    Fluorescent D-amino acid (FDAA) labelingVisualize cell wall and EPS incorporationSpatial patterns of EPS deposition
  • Systems biology approaches:

    • Multi-omics integration:
      Combine transcriptomics, proteomics, metabolomics, and phosphoproteomics data

    • Network analysis algorithms:
      Identify regulatory hubs and feedback loops in the quorum sensing-EpsB-EPS network

    • Computational modeling:
      Develop predictive models of how perturbations in EpsB function affect quorum sensing feedback

    • Application impact: Develop holistic understanding of the feedback mechanisms between EPS production and quorum sensing regulation

  • In planta technologies:

    • Plant-bacteria dual RNA-seq:
      Simultaneously capture plant and bacterial transcriptomes during infection

    • Mass spectrometry imaging:
      Map spatial distribution of EPS and quorum sensing molecules in infected plant tissues

    • Application impact: Understand how plant microenvironment affects EpsB function and EPS production

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.