Recombinant Ralstonia solanacearum Putative zinc metalloprotease RSc1411 (RSc1411)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Source and Expression:

  • Host organism: Ralstonia solanacearum, a soil-borne Gram-negative bacterium causing wilt disease in >200 plant species .

  • Recombinant production: Expressed in Escherichia coli with an N-terminal His tag .

  • Sequence: Full-length (1–462 amino acids; UniProt ID: Q8XZI4) .

Role in Pathogenesis:

  • RSc1411 belongs to the Rip (Ralstonia-injected protein) effector family, which modulates plant immune responses .

  • Zinc metalloprotease activity is linked to the HEXXH motif, a conserved Zn²⁺-binding domain critical for enzymatic function .

Key Findings:

  • Hypersensitive Response (HR) Induction:

    • Rip36 (a homolog) triggers HR in nonhost plants like Solanum torvum via Zn-dependent protease activity .

    • Mutation of the Zn-binding motif (e.g., E149A) abolishes HR induction without affecting translocation .

  • Mitochondrial Interaction:

    • RipX (another Rip effector) suppresses ATP synthase (atpA) transcription in Nicotiana benthamiana, altering defense signaling .

Enzymatic and Biotechnological Applications

Catalytic Efficiency:

  • Zinc metalloproteases like RSc1411 are engineered for industrial applications. A mutant variant (rsepA1) showed 4.2-fold higher catalytic efficiency toward casein compared to wild-type enzymes .

Expression Systems:

  • E. coli remains a preferred host for recombinant production due to scalability and cost-effectiveness .

  • Codon optimization and CRISPR/Cas9-mediated editing improve yield and stability .

Industrial Relevance:

ApplicationExampleSource
BiopharmaceuticalsAntibody glycosylation in engineered E. coli
Enzyme EngineeringError-prone PCR for enhanced activity

Comparative Analysis of Zinc Metalloproteases

FeatureRSc1411Salmonella GtgA/GogAE. coli NleC
Zn-binding MotifHEXXHHEXXHHEXXH
SubstratePlant proteinsHost transcription factorsNF-κB
Pathogenic RoleImmune suppressionImmune evasionImmune suppression

Challenges and Future Directions

  • Functional Validation: Direct evidence of RSc1411’s protease activity and host targets remains limited.

  • Inhibitor Development: Phosphonate-based zinc-binding groups show promise for selective metalloprotease inhibition .

  • Structural Studies: Cryo-EM or X-ray crystallography could elucidate substrate-binding regions .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
RSc1411; RS05281; Putative zinc metalloprotease RSc1411
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-462
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
RSc1411
Target Protein Sequence
MLTVLAFVFAIAVLIVVHELGHYSVARLCGVKVLRFSVGFGKVLFRRVGRGPDRTEWTLC AIPLGGYVKMLGESARDPERDPPIPPEDLPRTFDHQPVYKRFAIVAAGPVFNFLLAIALY ALLAWVGAQEPLPILGAPPPGSIAAQADLRAKDRVVAVGTDEEAPTPVRAWSDVRMRLYE AGIGGRDAIVQVRGADGAERTVRLRELPSAARSPQVDVIEQVGLRLLGGPVTIAEVLPGS AGERAGLRRGDQIVRFAGQPADQASDLIRWIRAMPEQNASIDILRDGLPMTLPVRLGADA DSANPGGPKLGKLGAQLSQHVETELIRDEPVHALGHAMREVWRTSMLSLKVLGKMIVGQA SLQNLSGPITVADFAGKAASLGWQSFVAFLALISVSLGVLNLLPVPVLDGGHLLYYCVEF LTGKPVPESWQAVLQKIGIACILLLTSLALYNDLSRLFLAHG
Uniprot No.

Target Background

Database Links

KEGG: rso:RSc1411

STRING: 267608.RSc1411

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is RSc1411 and what structural features characterize this protein?

    RSc1411 is a putative zinc metalloprotease from Ralstonia solanacearum strain GMI1000 (also known as Ralstonia pseudosolanacearum GMI1000), consisting of 462 amino acids . This protein is characterized by the presence of the highly conserved HEXXH zinc-binding motif (specifically located at residues H362 to H366) and a third zinc ligand motif GXXNEXXSD (at residues G382 to D390) .

    Structural analysis reveals RSc1411 is likely a transmembrane protein with its N-terminal portion embedded in the membrane. The AlphaFold predicted structure (AF_AFQ8XZI4F1) shows a high confidence model with a global pLDDT score of 89.84, indicating a reliable structural prediction . The protein contains a signal peptide of approximately 27 amino acids at its N-terminus, suggesting it undergoes secretion .

  • How is RSc1411 classified within protease families and what functional domains does it contain?

    RSc1411 belongs to the M4 family of metalloproteases (EC 3.4.24.-), also known as the thermolysin-like family . Members of this family are typically secreted bacterial enzymes that degrade extracellular proteins, which aligns with RSc1411's predicted signal peptide.

    Based on studies of similar M4 metalloproteases, RSc1411 likely has a modular structure comprising:

    • A signal sequence (~27 amino acids)

    • An N-terminal proregion containing a fungalysin/thermolysin propeptide motif

    • A protease region containing the catalytic domain and alpha-helical domain

    • A C-terminal extension potentially containing bacterial prepeptidase C-terminal (PPC) domains

    The catalytic core retains the structural topology characteristic of the Zincin superfamily, with the active-site cleft bifurcated by N-terminal and C-terminal subdomains .

  • What is known about the expression and purification of recombinant RSc1411?

    Recombinant RSc1411 has been successfully expressed in E. coli with an N-terminal His-tag . The expressed protein is typically purified using affinity chromatography and is available in lyophilized powder form for research applications.

    For optimal handling of recombinant RSc1411:

    • Storage conditions: -20°C to -80°C for extended storage

    • Working conditions: Aliquots stable at 4°C for up to one week

    • Reconstitution: Tris/PBS-based buffer (pH 8.0) with 6% trehalose

    • Final storage buffer: Addition of glycerol (typically 50%) is recommended for long-term stability

    Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

  • What role might RSc1411 play in Ralstonia solanacearum pathogenicity?

    While the specific function of RSc1411 in R. solanacearum pathogenicity hasn't been fully characterized in the provided search results, insights can be drawn from studies of similar metalloproteases in plant pathogens:

    R. solanacearum is a notorious plant-pathogenic bacterium that causes bacterial wilt in several important crop plants . The type III secretion system (T3SS) and its effectors play crucial roles in pathogenicity . Though RSc1411 is not explicitly mentioned as a T3SS effector, metalloproteases in bacterial pathogens often contribute to virulence through:

    • Degradation of host defense proteins

    • Processing of bacterial virulence factors

    • Modulation of signaling pathways

    • Interference with host immune responses

    Studies of other R. solanacearum proteins demonstrate that specific effectors like RipJ can function as avirulence determinants in certain plant species, triggering host defense responses . As a putative zinc metalloprotease, RSc1411 might similarly interact with host systems, either promoting infection or potentially triggering resistance responses.

Advanced Research Questions

  • What are the predicted active site residues of RSc1411 and how might they function in catalysis?

    Based on studies of M4 family metalloproteases and structural predictions for RSc1411, the critical catalytic residues likely include:

    • Two histidines within the HEXXH motif (H362 and H366) that serve as zinc ligands

    • The glutamate residue (E363) within the HEXXH motif that functions as an active site residue

    • A third zinc ligand glutamate (E383) located in the GXXNEXXSD motif approximately 20 residues downstream from the HEXXH motif

    The catalytic mechanism likely follows that of other M4 metalloproteases, where:

    1. The zinc ion is coordinated by the two histidines, the glutamate from GXXNEXXSD, and a water molecule

    2. The glutamate in the HEXXH motif acts as a general base, activating the water molecule for nucleophilic attack

    3. The activated water molecule attacks the carbonyl carbon of the peptide bond

    4. A tetrahedral intermediate forms and subsequently collapses, cleaving the peptide bond

    Site-directed mutagenesis experiments targeting these residues would be valuable for confirming their roles in catalysis. Based on studies of similar enzymes, substitution of H362, H366, or E383 would likely abolish zinc binding and therefore catalytic activity, while mutation of E363 would disrupt the general base functionality needed for water activation .

  • How can researchers design experiments to determine the substrate specificity of RSc1411?

    Determining substrate specificity for RSc1411 would require a multi-faceted approach:

    Method 1: Peptide Library Screening

    • Generate a diverse peptide library with fluorogenic or chromogenic reporters

    • Incubate recombinant RSc1411 with the peptide library

    • Identify cleaved peptides using mass spectrometry

    • Analyze cleavage sites to determine sequence preferences

    Method 2: Proteomic Identification of Cleavage Sites (PICS)

    1. Generate a peptide library from a proteome (e.g., from plant host tissue)

    2. Treat with RSc1411

    3. Enrich and identify neo-N-terminal peptides by mass spectrometry

    4. Map cleavage sites and derive consensus sequences

    Method 3: Comparative Kinetic Analysis

    Design a panel of defined substrates with systematic variations around a core sequence and measure enzymatic parameters:

    Substrate Variantkcat (s-1)KM (μM)kcat/KM (M-1s-1)Relative Efficiency
    Reference---1.0
    P1 position X----
    P2 position Y----
    P3 position Z----

    Similar approaches have been successfully used with other bacterial metalloproteases, including those from the M4 family. For example, in studies of thermolysin-like proteases, optimal substrates often contain hydrophobic residues at the P1' position .

  • What approaches can be used to investigate the potential regulation of RSc1411 expression during plant infection?

    Several complementary approaches can be employed to study RSc1411 regulation during infection:

    Transcriptional Analysis:

    1. qRT-PCR time-course studies: Monitor RSc1411 expression levels at different stages of infection

    2. RNA-Seq analysis: Compare transcriptome profiles between in vitro growth and in planta conditions

    3. Reporter gene fusions: Create transcriptional fusions between the RSc1411 promoter and reporter genes (e.g., lacZ or fluorescent proteins) to visualize expression patterns

    Promoter Analysis:

    • Identify potential transcription factor binding sites in the RSc1411 promoter region

    • Create promoter deletions to map essential regulatory elements

    • Perform electrophoretic mobility shift assays (EMSAs) to identify interacting transcription factors

    Regulatory Network Integration:

    Studies on R. solanacearum have revealed several regulatory systems that control virulence, including:

    • The PhcA quorum sensing system that regulates 3-OH MAME production

    • The SolI/SolR system controlling N-acyl-homoserine lactone signals

    Investigating whether RSc1411 is regulated by these systems would provide valuable insights into its role in pathogenesis. For example, performing expression analysis in phcA or other regulatory mutants could reveal hierarchical control mechanisms.

    Similar approaches have successfully identified regulatory patterns for other R. solanacearum genes, such as those encoding type III secretion system components .

  • How might RSc1411 differ from other zinc metalloproteases in the Ralstonia genus, and what evolutionary insights can be gained from comparative analyses?

    Comparative genomic and structural analysis of RSc1411 with other Ralstonia metalloproteases can reveal evolutionary patterns and functional specialization:

    Phylogenetic Analysis:

    1. Identify homologs of RSc1411 across Ralstonia species and strains

    2. Construct phylogenetic trees to determine evolutionary relationships

    3. Calculate selection pressures (dN/dS ratios) to identify regions under positive or purifying selection

    Domain Architecture Comparison:

    Compare the modular structure of RSc1411 with other bacterial metalloproteases, particularly focusing on:

    • Presence/absence of signal peptides

    • Conservation of the catalytic HEXXH motif

    • Variations in C-terminal extensions and auxiliary domains

    For example, research on M4 family metalloproteases has revealed that some possess unique modular structures with prepeptidase C-terminal (PPC) domains and P domains that are uncommon in bacterial proteases .

    Structural Modeling and Comparison:

    The AlphaFold predicted structure of RSc1411 (AF_AFQ8XZI4F1) provides a starting point for structural comparisons with other metalloproteases . Key areas to analyze include:

    • Active site geometry and substrate binding pocket architecture

    • Surface electrostatic properties

    • Predicted flexibility of substrate-binding loops

    These analyses could reveal adaptations specific to RSc1411's biological role and might explain host specificity or substrate preferences.

  • What methods are most effective for investigating the role of RSc1411 in plant-pathogen interactions?

    A comprehensive investigation of RSc1411's role in plant-pathogen interactions would employ multiple complementary approaches:

    Genetic Approaches:

    1. Gene knockout/knockdown: Create RSc1411 deletion mutants using homologous recombination or CRISPR-Cas systems

    2. Complementation studies: Reintroduce wild-type or mutant versions of RSc1411 to confirm phenotypes

    3. Site-directed mutagenesis: Create catalytically inactive versions (e.g., by mutating the HEXXH motif) to distinguish enzymatic from structural roles

    Phenotypic Analysis:

    • Compare wild-type and mutant strains for:

      • Virulence in various plant hosts

      • Growth rates in different conditions

      • Biofilm formation

      • Motility

    Localization Studies:

    • Create fluorescent protein fusions to track RSc1411 localization during infection

    • Use immunogold labeling and electron microscopy for high-resolution localization

    Host Response Analysis:

    • Transcriptome analysis of plant hosts infected with wild-type vs. RSc1411 mutant bacteria

    • Measurement of defense-related compounds (e.g., phytoalexins, pathogenesis-related proteins)

    • Assessment of host cell death patterns

    Similar approaches have been used to characterize other R. solanacearum factors, such as RipJ, which was identified as an avirulence determinant in Solanum pimpinellifolium LA2093 . This integrated approach can provide comprehensive insights into the specific contribution of RSc1411 to bacterial pathogenesis.

  • What expression systems and purification strategies are optimal for obtaining high yields of active recombinant RSc1411?

    Based on the search results and general principles for metalloprotease production, the following strategies are recommended:

    Expression Systems:

    1. E. coli-based expression: The search results indicate successful expression in E. coli . Consider using:

      • BL21(DE3) for high expression levels

      • Origami or SHuffle strains if disulfide bonds are present

      • Arctic Express for low-temperature expression to improve folding

    2. Alternative expression systems to consider:

      • Pseudomonas expression systems for a more native-like environment

      • Cell-free expression systems for potentially toxic proteases

    Expression Optimization:

    ParameterOptimization Strategy
    TemperatureTest expression at 16°C, 25°C, and 37°C
    InductionCompare IPTG concentrations (0.1-1.0 mM)
    MediaTest rich media (LB, TB) vs. minimal media
    Co-expressionConsider co-expressing with chaperones (GroEL/ES, DnaK)
    AdditivesAdd zinc to media (10-100 μM ZnCl₂)

    Purification Strategy:

    1. Initial capture: Immobilized metal affinity chromatography (IMAC) using the His-tag

    2. Intermediate purification: Ion exchange chromatography based on the protein's pI

    3. Polishing: Size exclusion chromatography

    4. Buffer optimization: Include zinc in buffers (typically 10 μM ZnCl₂) to maintain active site integrity

    Active Enzyme Production:

    If RSc1411 is expressed as a proenzyme (containing the N-terminal proregion), activation may be required:

    1. Limited proteolysis to remove the proregion

    2. Autocatalytic activation under controlled conditions

    3. Testing different pH and temperature conditions for optimal activation

    For storage, reconstitution in Tris/PBS-based buffer with 6% trehalose and addition of 50% glycerol for long-term storage at -20°C/-80°C has been reported to be effective .

  • How might researchers design inhibitors targeting RSc1411 as potential control agents for bacterial wilt disease?

    Designing inhibitors for RSc1411 as potential control agents would follow a systematic structure-based approach:

    Target Validation:

    1. Confirm the role of RSc1411 in virulence through knockout studies

    2. Determine if inhibition of enzymatic activity correlates with reduced pathogenicity

    3. Assess conservation across Ralstonia strains to ensure broad-spectrum activity

    Inhibitor Design Strategies:

    1. Structure-based design:

      • Use the AlphaFold predicted structure (AF_AFQ8XZI4F1) as a starting point

      • Focus on the active site containing the HEXXH motif

      • Design compounds that coordinate with the catalytic zinc

    2. Fragment-based approach:

      • Screen fragment libraries for binding to RSc1411

      • Identify binding hotspots and expand fragments into more potent inhibitors

    3. Peptidomimetic approach:

      • Design peptide-like molecules based on substrate preferences

      • Incorporate zinc-binding groups (e.g., hydroxamates, carboxylates, thiols)

    4. Natural product screening:

      • Test plant defense compounds (particularly from resistant plants)

      • Screen microbial extracts for inhibitory activity

    Evaluation Pipeline:

    StageAssayPurpose
    Primary screeningFluorogenic substrate assayIdentify active compounds
    Secondary screeningIC₅₀ determinationQuantify potency
    Mechanism studiesEnzyme kineticsDetermine inhibition type
    Selectivity profilingTesting against human MMPsAssess selectivity
    Cell-based testingBacterial growth inhibitionConfirm cell penetration
    Plant assaysDisease reduction in plantsValidate in vivo efficacy

    This approach has been successful for other bacterial proteases and could yield valuable tools for both studying RSc1411 function and potentially controlling bacterial wilt disease.

  • What techniques can be used to study the potential protein-protein interactions of RSc1411 within Ralstonia solanacearum?

    Understanding the protein interaction network of RSc1411 would provide valuable insights into its biological function and regulation. The following techniques are recommended:

    In Vitro Approaches:

    1. Pull-down assays:

      • Use purified His-tagged RSc1411 as bait

      • Identify interacting partners from bacterial lysates by mass spectrometry

    2. Surface Plasmon Resonance (SPR):

      • Immobilize RSc1411 on a sensor chip

      • Test interactions with candidate partner proteins

      • Determine binding kinetics and affinities

    3. Isothermal Titration Calorimetry (ITC):

      • Directly measure thermodynamic parameters of protein-protein interactions

      • Quantify binding stoichiometry

    In Vivo Approaches:

    1. Bacterial Two-Hybrid:

      • Test specific protein pairs for interactions

      • Suitable for initial screening of candidate interactors

    2. Crosslinking Mass Spectrometry:

      • Use chemical crosslinkers in live bacteria

      • Identify crosslinked peptides by MS/MS

      • Map interaction interfaces

    3. Proximity-Dependent Biotinylation:

      • Similar to the TurboID approach used in search result

      • Create RSc1411-TurboID fusions to biotinylate proximal proteins

      • Identify biotinylated proteins by streptavidin purification and mass spectrometry

    The proximity labeling approach has been successfully employed to study protein interactions in Trypanosoma brucei RESC complexes, revealing functional relationships between different protein components . The protocol from this study could be adapted for investigating RSc1411 interactions:

    • Express RSc1411-TurboID fusion protein

    • Isolate biotinylated proteins using streptavidin beads

    • Perform mass spectrometry to identify proteins in proximity to RSc1411

    • Compare results with control samples to identify specific interactions

    This systematic approach would help place RSc1411 within its functional context in R. solanacearum cellular processes.

  • How can researchers investigate the potential post-translational regulation mechanisms of RSc1411?

    As a zinc metalloprotease, RSc1411 likely undergoes multiple levels of post-translational regulation. The following approaches would help elucidate these mechanisms:

    Proenzyme Activation:

    Based on knowledge of M4 family metalloproteases, RSc1411 is likely synthesized as an inactive preproenzyme . To study its activation:

    1. Express the full-length protein including the predicted N-terminal proregion

    2. Monitor autocatalytic processing under different conditions (pH, temperature)

    3. Test the effect of specific mutations at the predicted proregion-protease junction

    4. Identify any bacterial proteases that might cleave the proregion

    Post-Translational Modifications:

    1. Phosphorylation:

      • Use phosphoproteomic approaches to identify potential phosphorylation sites

      • Create phosphomimetic mutants (S/T to D/E) to assess functional effects

    2. Metal coordination:

      • Test activity with different metals (Zn²⁺, Co²⁺, Mn²⁺)

      • Use chelators to strip metals and reconstitute with defined metal ions

      • Perform isothermal titration calorimetry to determine metal binding constants

    Protein-Protein Interactions:

    Identify potential regulatory partners using the techniques described in question 13. Focus particularly on:

    • Potential inhibitory proteins

    • Proteins that might modulate substrate access

    • Factors that control subcellular localization

    Environmental Regulation:

    Assess how environmental conditions affect RSc1411 activity and stability:

    ConditionParameter RangeMeasurement
    pH4.0-9.0Activity, conformational changes
    Temperature20-70°CStability, activity
    Redox stateReduced/oxidizedStructural integrity, activity
    Plant extractsVarious hostsActivation/inhibition profiles

    This comprehensive approach would reveal the multi-faceted regulation of RSc1411 activity, which is crucial for understanding its role in bacterial physiology and pathogenesis.

  • What technical challenges might researchers face when studying RSc1411 and how can they be addressed?

    Research on bacterial metalloproteases like RSc1411 presents several technical challenges that require specific strategies:

    Challenge 1: Autoproteolysis during expression and purification

    Solution:

    • Express the protein at lower temperatures (16-20°C)

    • Include protease inhibitors in purification buffers

    • Consider expressing an inactive mutant (e.g., E363A) for structural studies

    • Express the protein with its proregion intact, which often serves as an intrinsic inhibitor

    Challenge 2: Maintaining proper zinc coordination

    Solution:

    • Include 10-100 μM ZnCl₂ in all buffers

    • Avoid chelating agents like EDTA in buffers

    • Monitor metal content using atomic absorption spectroscopy or inductively coupled plasma mass spectrometry (ICP-MS)

    Challenge 3: Determining enzyme kinetics with complex macromolecular substrates

    Solution:

    • Develop specific assays with fluorogenic peptides based on predicted cleavage sites

    • For complex substrates, use techniques like SDS-PAGE time-course analysis with densitometry

    • Consider using techniques like MALDI-TOF MS to monitor substrate degradation patterns

    Challenge 4: Creating precise knockout mutants in R. solanacearum

    Solution:

    • Use natural transformation approaches as described in search result

    • Consider creating catalytically inactive point mutants rather than complete gene deletions

    • Validate mutants thoroughly at the genomic, transcriptomic, and proteomic levels

    Challenge 5: Studying RSc1411 function in planta

    Solution:

    • Develop specific antibodies against RSc1411 for immunolocalization

    • Create fluorescent protein fusions that maintain enzyme activity

    • Use in situ RT-PCR to localize transcriptional activity during infection

    These approaches have been successfully applied to other bacterial metalloproteases and would help overcome the specific challenges associated with studying RSc1411.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.