Recombinant Ralstonia solanacearum UPF0060 membrane protein RSp1275 (RSp1275)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
RSp1275; RS05320; UPF0060 membrane protein RSp1275
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
RSp1275
Target Protein Sequence
MEYLRIAFLFALTALAEIVGCYLPWLVLRQAKSAWLLMPAALSLALFAWLLTLHPTAAGR TYAAYGGMYIAVALAWLRVVDGATLTRWDIGGAAIALAGMAVIALQPQPT
Uniprot No.

Target Background

Database Links

KEGG: rso:RSp1275

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is RSp1275 and what is its significance in Ralstonia solanacearum research?

RSp1275 is a UPF0060 family membrane protein found in Ralstonia solanacearum (strain GMI1000). It consists of 110 amino acids and appears to be conserved within the Ralstonia genus. While the specific function of RSp1275 remains under investigation, it belongs to a bacterial species that utilizes numerous effector proteins to manipulate plant cellular functions during infection . Research into membrane proteins like RSp1275 is critical for understanding bacterial pathogenicity mechanisms and developing potential control strategies for this devastating plant pathogen.

How does RSp1275 compare with other virulence factors from Ralstonia solanacearum?

Unlike characterized effectors such as RipD, RipN, and RipTPS that have been shown to directly suppress plant immunity, the specific function of RSp1275 in pathogenicity has not been fully elucidated. Research shows that other Ralstonia effectors like RipD target plant vesicle-associated membrane proteins (VAMPs) to contribute to bacterial virulence . Similarly, RipN suppresses PAMP-triggered immunity and localizes to the endoplasmic reticulum and nucleus . RipTPS has been demonstrated to suppress flg22-triggered reactive oxygen species burst in Nicotiana benthamiana . Comparative studies between RSp1275 and these better-characterized effectors may provide insights into potential functional roles.

What expression systems are optimal for producing recombinant RSp1275?

Based on available research protocols, E. coli expression systems have been successfully employed to produce recombinant RSp1275 . When designing an expression strategy:

  • Use a full-length construct (amino acids 1-110) with an N-terminal His-tag for purification

  • Select an appropriate E. coli strain optimized for membrane protein expression (such as C41(DE3) or C43(DE3))

  • Consider lower induction temperatures (16-25°C) to improve proper folding of membrane proteins

  • Use specialized detergents during cell lysis and purification to maintain protein solubility

The choice of expression vector should include strong but controllable promoters (T7 or tac) and appropriate selection markers for stable maintenance .

What are the recommended storage and handling conditions for recombinant RSp1275?

To maintain protein stability and functionality, recombinant RSp1275 should be handled according to these guidelines:

ParameterRecommended ConditionNotes
Storage formLyophilized powderFor long-term storage
Temperature-20°C to -80°CAliquot to avoid freeze-thaw cycles
Buffer compositionTris/PBS-based buffer, pH 8.0Containing 6% trehalose for stability
Working solution0.1-1.0 mg/mL in deionized sterile waterAdd 5-50% glycerol for freezing
Handling precautionsCentrifuge briefly before openingBrings contents to bottom of vial
Freeze-thawAvoid repeated cyclesStore working aliquots at 4°C for up to one week

Following these protocols will help preserve protein integrity for experimental use .

How can researchers optimize purification of recombinant RSp1275?

Purification of membrane proteins like RSp1275 requires specialized approaches:

  • Solubilization: Use gentle detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) to extract the protein from membranes without denaturation

  • Affinity Chromatography: Utilize the His-tag for initial purification via nickel or cobalt-based affinity resins

  • Size Exclusion: Follow with size exclusion chromatography to remove aggregates and achieve >90% purity

  • Detergent Exchange: Consider exchanging harsh detergents with milder ones during the final purification steps

  • Quality Control: Verify purity via SDS-PAGE, with expected purity greater than 90%

When designing purification protocols, consider the hydrophobic nature of RSp1275 and its potential to aggregate in solution.

What techniques can elucidate the membrane topology and structural characteristics of RSp1275?

Determining the structure and topology of membrane proteins like RSp1275 requires multiple complementary approaches:

  • Computational Prediction:

    • Hydropathy analysis to predict transmembrane domains

    • Secondary structure prediction algorithms

    • Homology modeling based on related UPF0060 family proteins

  • Experimental Verification:

    • Cysteine scanning mutagenesis with membrane-impermeable labeling reagents

    • Protease protection assays to identify exposed regions

    • Fluorescence resonance energy transfer (FRET) with strategically placed fluorophores

  • Structural Determination:

    • Cryo-electron microscopy for 3D structure

    • X-ray crystallography (challenging for membrane proteins)

    • NMR spectroscopy for dynamic structural information

Researchers should combine multiple approaches to build a comprehensive structural model of RSp1275 within the membrane.

How might RSp1275 contribute to Ralstonia solanacearum pathogenicity based on research of similar bacterial proteins?

While the specific function of RSp1275 remains to be determined, research on other Ralstonia effectors provides context for potential mechanisms:

  • Immune Suppression: Similar to RipN and RipTPS, RSp1275 might suppress plant immune responses. RipN has been shown to suppress callose deposition and PAMP-triggered immunity marker genes , while RipTPS suppresses flg22-triggered reactive oxygen species burst .

  • Subcellular Targeting: The membrane localization of RSp1275 suggests potential involvement in host-pathogen membrane interactions. Other effectors like RipD localize to vesicles and target vesicle-associated membrane proteins (VAMPs) during infection .

  • Metabolic Interference: Some bacterial effectors alter host metabolism to favor infection. RipN, for example, alters NADH/NAD+ ratios in Arabidopsis .

Experimental approaches to test these hypotheses would include:

  • Transient expression of RSp1275 in plant cells followed by immune response assays

  • Co-immunoprecipitation to identify plant protein interaction partners

  • Mutational analysis to assess virulence contributions

What protein-protein interaction methods are most appropriate for identifying RSp1275 host targets?

To identify plant proteins that interact with RSp1275 during infection, researchers should consider:

  • In vitro Approaches:

    • Pull-down assays using purified recombinant RSp1275

    • Surface plasmon resonance (SPR) with candidate plant proteins

    • Protein arrays with plant proteome representation

  • Cell-based Methods:

    • Yeast two-hybrid (Y2H) with membrane adaptations (split-ubiquitin Y2H)

    • Bimolecular fluorescence complementation (BiFC) in plant cells

    • Proximity labeling techniques (BioID or APEX) in planta

  • Proteomics Approaches:

    • Co-immunoprecipitation followed by mass spectrometry

    • Crosslinking mass spectrometry for transient interactions

    • Comparative proteomics between wild-type and RSp1275 mutants

Research on other Ralstonia effectors suggests looking specifically at interactions with plant vesicle trafficking components, as RipD has been shown to target vesicle-associated membrane proteins during infection .

How does RSp1275 differ functionally from characterized effector proteins like RipD and RipN?

Based on the available research, key differences between RSp1275 and characterized Ralstonia effectors include:

ProteinLocalizationKnown FunctionsTarget Processes
RSp1275Membrane-associatedNot fully characterizedUnknown
RipDVesicles, subcellular compartmentsSuppresses plant immunity, targets VAMPsVesicle trafficking, lignin biosynthesis
RipNEndoplasmic reticulum, nucleusSuppresses PTI, alters NADH/NAD+ ratioEnergy metabolism, immune signaling
RipTPSNot specifiedSuppresses flg22-triggered ROS burstPAMP-triggered immunity

Unlike these effectors, which are secreted via the type III secretion system to target specific host processes, RSp1275 appears to be a membrane-associated protein, suggesting potentially different functional roles in bacterial physiology or host interaction.

What research techniques have been most successful in characterizing the function of other Ralstonia membrane proteins?

Successful approaches for characterizing Ralstonia membrane proteins include:

  • Localization Studies:

    • Fluorescent protein fusions observed during infection processes

    • Subcellular fractionation followed by immunoblotting

    • Immunogold labeling with electron microscopy

  • Functional Analyses:

    • Generation of knockout mutants for virulence assessment

    • Complementation studies with wild-type and mutated versions

    • Heterologous expression in model systems

  • Host Response Measurements:

    • Monitoring reactive oxygen species production (as seen with RipTPS)

    • Measuring expression of defense-related genes

    • Assessing callose deposition and other immune responses

Research on RipD showed its vesicular localization was enriched during infection, and its role was illuminated through interaction studies with plant VAMPs . Similar approaches could be applied to RSp1275.

What emerging technologies hold promise for deepening our understanding of RSp1275 function?

Several cutting-edge technologies could advance RSp1275 research:

  • Cryo-Electron Tomography: For visualizing membrane proteins in their native environment during infection

  • AlphaFold and Related AI Tools: For accurate structural prediction of membrane proteins

  • Single-Cell Transcriptomics: To understand plant responses to RSp1275 at cellular resolution

  • Nanobody Technology: For developing highly specific probes for RSp1275 localization and function

  • CRISPR-Cas Genome Editing: For precise modification of RSp1275 in Ralstonia to assess functional domains

These approaches could overcome current limitations in membrane protein research and provide unprecedented insights into RSp1275 function during plant-pathogen interactions.

How might understanding RSp1275 contribute to developing novel plant protection strategies?

Research into RSp1275 and related proteins could inform several approaches to plant protection:

  • Target-Based Inhibitor Design: If RSp1275 proves essential for virulence, small molecule inhibitors could be developed

  • Engineered Plant Resistance: Plants could be engineered to recognize and respond to RSp1275, similar to how RipTPS G induces cell death in Nicotiana tabacum

  • Diagnostic Tools: RSp1275-specific antibodies or nucleic acid-based detection methods could improve early detection of Ralstonia infections

  • Immunomodulation: Understanding how membrane proteins like RSp1275 interact with plant immunity could inform strategies to enhance natural plant defenses

Research on other Ralstonia effectors shows that some, like RipTPS G, can function as avirulence determinants when recognized by plant immunity systems , suggesting similar potential for RSp1275-targeted resistance strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.