Recombinant Ralstonia solanacearum UPF0187 protein RSc3414 (RSc3414)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RSc3414; RS01793; UPF0187 protein RSc3414
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)
Target Names
RSc3414
Target Protein Sequence
MVVRPHLHWFRMLLAWRGSVLPQLLPRLFLIFCISLVAMAVHVHWLPITVNLSTTPFSLI GIALAVFLGFRNNASYDRYWEARKLWGQLLNDARSMTRQALTLPRETLAAADVREFVQVL GALPHALRHQLRRTDPRDDLSARLPAPLFERVMASRYRPAALMLWLGEWVRQRSREGSLD AWAVLAFDRNLGSLSNVIGGCERIVSTPLPFAYSVMIHRTVYFFCAALPFGLVESIGNFT PVFSVFVAYAFMAHEAIAAQIEEPFGTEDNDLALNTMSLMIEDAVRDLIGEPSLGDEAAA RAFILD
Uniprot No.

Target Background

Database Links

KEGG: rso:RSc3414

STRING: 267608.RSc3414

Protein Families
UPF0187 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the RSc3414 protein and what organism does it come from?

RSc3414 is a UPF0187 family protein from Ralstonia solanacearum, a soil-borne bacterial plant pathogen. The protein consists of 306 amino acid residues and has a UniProt ID of Q8XTY1. The gene is also known by the synonyms RS01793 and UPF0187 protein RSc3414 . Ralstonia solanacearum has been classified into various races and biovars, with race 3 (biovar 2A) being particularly significant as a quarantine pest in Europe, Canada, and the United States .

What are the recommended storage and handling conditions for recombinant RSc3414 protein?

The recommended storage and handling conditions for recombinant RSc3414 protein are:

ParameterRecommendation
Storage temperature-20°C/-80°C upon receipt
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
AliquotingNecessary for multiple use
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% (final concentration)
Working storage4°C for up to one week
Freeze-thaw cyclesAvoid repeated cycles

Prior to opening, it is recommended to briefly centrifuge the vial to bring contents to the bottom. After reconstitution, adding glycerol (typically to 50% final concentration) and aliquoting for long-term storage at -20°C/-80°C is advised .

What expression systems are optimal for producing recombinant RSc3414 protein?

Based on available research data, E. coli has been successfully used as an expression system for recombinant RSc3414 protein. The recombinant full-length protein (amino acids 1-306) can be produced with an N-terminal His-tag to facilitate purification .

For optimal expression:

  • Clone the RSc3414 gene into an appropriate expression vector containing a His-tag sequence

  • Transform the construct into a suitable E. coli strain optimized for protein expression

  • Induce protein expression under controlled conditions

  • Purify using affinity chromatography

  • Verify protein integrity through SDS-PAGE analysis

When designing expression constructs, researchers should consider codon optimization for E. coli if expression yields are low, as bacterial codon usage may differ from that of Ralstonia solanacearum.

How can I design knockout or complementation studies to assess RSc3414 function?

To design knockout or complementation studies for RSc3414, researchers can adapt methodologies used for similar studies with other Ralstonia proteins. Based on approaches used for RipTPS (another R. solanacearum protein), the following strategy is recommended:

  • For knockout studies:

    • Amplify the upstream and downstream fragments of the RSc3414 gene from genomic DNA

    • Fuse these fragments using overlap PCR

    • Insert the resulting fragment into a suitable vector (e.g., pK18mobsacB)

    • Transform the recombinant vector into R. solanacearum

    • Generate deletion mutants through homologous recombination-based procedures

    • Verify deletion through PCR and/or sequencing

  • For complementation studies:

    • Clone RSc3414 into an appropriate vector (such as pHM1)

    • Introduce the recombinant plasmid into mutant strains through electroporation

    • Select transformants on appropriate antibiotics

    • Validate complementation through phenotypic analyses and/or protein expression verification

What approaches can be used to study protein-plant interactions involving RSc3414?

Several approaches can be employed to study interactions between RSc3414 and plant hosts:

  • Transient expression in plant systems:

    • Clone RSc3414 into plant expression vectors

    • Deliver into plant tissues via Agrobacterium-mediated transformation

    • Assess cellular responses (e.g., cell death, defense gene activation)

    • Similar methods have been used for studying RipTPS effects in Nicotiana species

  • Reactive oxygen species (ROS) measurement:

    • Express RSc3414 in plant tissues

    • Challenge with plant immunity elicitors (e.g., flg22)

    • Measure ROS production using luminol-based assays

    • Compare with control plants to assess immune suppression

    • Similar methods revealed that RipTPS suppresses flg22-triggered ROS burst in N. benthamiana

  • Defense gene expression analysis:

    • Express RSc3414 in plant tissues

    • Extract RNA and perform RT-qPCR to assess expression of defense-related genes

    • Compare with appropriate controls

    • This approach showed that RipTPS G enhanced expression of HR-related genes NtHIN1 and NtHsr203J in N. tabacum

How can site-directed mutagenesis be used to identify functional domains in RSc3414?

Site-directed mutagenesis is a powerful approach to identify functional domains within proteins like RSc3414. Based on methodologies used for similar proteins:

  • Design PCR primers containing the desired mutations

  • Perform PCR-based site-directed mutagenesis using a high-fidelity polymerase

  • Clone the mutated genes into appropriate vectors

  • Express and purify the mutant proteins

  • Assess function through appropriate assays

For RSc3414, researchers might target:

  • Conserved residues identified through sequence alignment with homologous proteins

  • Predicted functional domains based on structural analysis

  • Residues implicated in protein-protein interactions

Similar approaches with RipTPS revealed that three specific amino acid residues were jointly required for recognition in N. tabacum, and that mutations in conserved residues in the TPS domain did not affect virulence function .

What quasi-experimental designs are appropriate for studying RSc3414 function in planta?

When designing experiments to study RSc3414 function in plants, several quasi-experimental design approaches can be considered:

  • Pre-post designs with non-equivalent control groups:

    • Compare plants expressing RSc3414 with control plants

    • Measure outcomes before and after pathogen challenge

    • Use statistical methods to account for baseline differences

    • This design is relatively simple but may be affected by history bias or selection bias

  • Interrupted time series:

    • Monitor plant responses over multiple time points before and after RSc3414 introduction

    • Provides better control for temporal trends

    • Can reveal immediate versus delayed effects of RSc3414

  • Stepped wedge designs:

    • Introduce RSc3414 to different plant groups at different time points

    • Each group serves as its own control

    • Particularly useful when studying effects across diverse plant genotypes

To strengthen internal validity:

  • Select appropriate non-equivalent control groups with balanced distribution of known factors

  • Obtain pre-test data or baseline characteristics

  • Consider partial randomization elements where feasible

  • Employ multiple control groups to determine if effects are robust across different conditions

  • Examine critical windows where RSc3414 would be expected to have the most impact

What challenges might arise in purifying active RSc3414 protein and how can they be addressed?

Several challenges may arise when purifying active RSc3414 protein:

ChallengePotential Solution
Low protein solubility- Optimize induction conditions (temperature, IPTG concentration)
- Try different solubilization buffers
- Consider fusion tags known to enhance solubility (MBP, SUMO)
- Express as fragments if certain domains cause aggregation
Protein degradation- Include protease inhibitors in all buffers
- Work at reduced temperatures (4°C)
- Minimize purification time
- Consider adding stabilizing agents (glycerol, trehalose)
Low purity- Optimize washing conditions during affinity purification
- Consider additional purification steps (ion exchange, size exclusion)
- Validate purity by SDS-PAGE (>90% purity is recommended)
Loss of activity- Avoid repeated freeze-thaw cycles
- Store working aliquots at 4°C for up to one week
- For long-term storage, add glycerol (5-50%) and store at -20°C/-80°C

How can I verify if my RSc3414 construct maintains native protein function?

To verify that recombinant RSc3414 maintains its native function:

  • Complementation assays:

    • Introduce the recombinant RSc3414 into a RSc3414 knockout strain

    • Assess whether it restores wild-type phenotypes

    • Similar approaches have been used for RipTPS studies

  • Protein-protein interaction studies:

    • Identify known interaction partners of RSc3414 (if any)

    • Perform pull-down assays, yeast two-hybrid, or co-immunoprecipitation

    • Verify that recombinant RSc3414 maintains these interactions

  • Functional assays:

    • Develop assays specific to the predicted function of RSc3414

    • For proteins involved in plant-pathogen interactions, assess ability to induce or suppress plant defense responses

    • RipTPS studies measured ROS suppression and induction of HR-related genes

How might studying RSc3414 contribute to understanding Ralstonia solanacearum pathogenicity?

Research on RSc3414 could provide several insights into R. solanacearum pathogenicity:

  • Potential role in virulence:

    • Many bacterial effectors contribute to suppression of host immunity

    • Like RipTPS, RSc3414 might suppress defense responses such as ROS burst

    • Understanding its molecular targets could reveal novel virulence mechanisms

  • Host specificity determinants:

    • R. solanacearum has a wide host range, affecting various economically important crops

    • Effector proteins often contribute to host range determination

    • RSc3414 might play a role in host-specific interactions

  • Evolutionary insights:

    • Comparing RSc3414 across different R. solanacearum strains and races could reveal adaptation patterns

    • Similar analyses with RipTPS identified amino acid polymorphisms determining recognition specificity

What are the most promising research directions for RSc3414 in plant disease management?

Research on RSc3414 could contribute to plant disease management strategies in several ways:

  • Development of resistant crop varieties:

    • If RSc3414 functions as an avirulence determinant in certain plant species (like RipTPS G in N. tabacum)

    • Identifying corresponding plant resistance genes could facilitate breeding programs

    • Engineering recognition of RSc3414 in susceptible crop species might provide novel resistance strategies

  • Novel disease control agents:

    • Understanding RSc3414 function could reveal targets for antimicrobial development

    • Inhibitors of RSc3414 might reduce bacterial virulence without selecting for resistance

  • Diagnostic tools:

    • RSc3414 sequence variation between strains might be useful for developing strain-specific detection methods

    • This is particularly important for quarantine pests like R. solanacearum race 3 biovar 2A

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.