Recombinant Pelophylax esculentus Aquaporin FA-CHIP (AQPA)

What is Pelophylax esculentus Aquaporin FA-CHIP (AQPA) and what is its structural composition?

Pelophylax esculentus (Edible frog) Aquaporin FA-CHIP (AQPA) is a water channel protein that belongs to the larger aquaporin family. It consists of 272 amino acids with the complete sequence: MASEFKKKAFWRAVIAEFLAMILFVFISIGAALGFNFPIEEKANQTVGRSQDIVKVSLAFGISIATMAQSVGHVSGAHLNPAVTLGCLLSCQISILKAVMYIIAQCLGAVVATAILSGITSGLENNSLGLNGLSPGVSAGQGLGVEILVTFQLVLCVVAVTDRRRHDVSGSVPLAIGLSVALGHLIAIDYTGCGMNPARSFGSAVLTKNFTYHWIFWVGPMIGGAAAAIIYDFILAPRTSDLTDRMKVWTNGQVEEYELDGDDNTRVEMKPK . Like other aquaporins, it functions as a membrane channel facilitating the transport of water molecules across cellular membranes, which is vital for various physiological processes.

How does AQPA compare structurally to human aquaporins?

The comparison between amphibian AQPA and human aquaporins reveals important evolutionary and functional relationships. While specific comparison data for Pelophylax esculentus AQPA is limited in the search results, research on aquaporins generally shows that these proteins maintain a conserved structural fold across species despite sequence variations. Human aquaporins have been systematically studied and produced in expression systems such as Pichia pastoris for structural and functional characterization . The comparative analysis is essential for understanding species-specific adaptations in water regulation mechanisms.

What are the optimal expression systems for producing recombinant Pelophylax esculentus AQPA?

For recombinant production of Pelophylax esculentus AQPA, E. coli has been demonstrated as an effective expression system. The protein can be successfully expressed as a full-length construct (1-272 amino acids) with an N-terminal His-tag . Alternative expression systems such as Pichia pastoris have been used successfully for producing other aquaporins and may offer advantages for eukaryotic membrane proteins like AQPA . When selecting an expression system, researchers should consider:

What purification strategies yield the highest purity and functional retention for recombinant AQPA?

Recombinant Pelophylax esculentus AQPA with His-tag can be purified to greater than 90% purity as determined by SDS-PAGE . For optimal purification while maintaining functionality, the following methodological approach is recommended:

• Affinity chromatography using the N-terminal His-tag with Ni-NTA matrices

• Size-exclusion chromatography to separate monomeric from aggregated forms

• Buffer optimization to maintain stability during purification steps

For storage and handling, the purified protein can be lyophilized and stored at -20°C/-80°C. To reconstitute, use deionized sterile water to a concentration of 0.1-1.0 mg/mL, and consider adding 5-50% glycerol (with 50% being standard) for long-term storage stability . Repeated freeze-thaw cycles should be avoided to maintain protein integrity.

What experimental designs are most appropriate for studying AQPA functionality?

When designing experiments to study AQPA functionality, researchers should consider implementing reversal designs that allow for measuring the protein's function under various conditions. This approach contains repeated measures of the behavior (in this case, water transport or other functional parameters) in at least three phases: baseline, intervention, and return to baseline .

For aquaporin research, this could translate to:

• Baseline: Measuring membrane permeability without AQPA

• Intervention: Introducing recombinant AQPA and measuring changes in permeability

• Return to baseline: Inhibiting AQPA function (using mercury compounds or other inhibitors) to verify the observed effects

This rigorous experimental approach allows researchers to establish causal relationships between AQPA presence and water transport functionality.

How can researchers accurately measure water permeability mediated by AQPA?

To quantify water permeability mediated by AQPA, researchers can utilize several complementary techniques:

• Stopped-flow light scattering: Measures the rate of cell volume change in response to osmotic gradients, providing quantitative data on water flux rates through the membrane

• Proteoliposome swelling assays: Recombinant AQPA can be reconstituted into liposomes, and water transport can be measured by monitoring changes in liposome size upon exposure to osmotic gradients

• Xenopus oocyte expression system: AQPA cRNA can be injected into oocytes, and water permeability can be measured by monitoring cell swelling in hypotonic conditions

Each of these methods has distinct advantages and limitations, and combining multiple approaches provides more robust functional characterization.

How can molecular techniques distinguish Pelophylax esculentus AQPA from closely related species?

Molecular differentiation of Pelophylax esculentus AQPA from related species can be accomplished using PCR-based methods that exploit size differences in genomic markers. The serum albumin intron-1 (SAI-1) shows species-specific length variations that can be utilized for identification . Additionally, the RanaCR1 non-LTR retrotransposon is approximately 550 bp shorter in P. lessonae than in P. ridibundus, providing another marker for species differentiation .

For reliable molecular identification, researchers should:

• Amplify the serum albumin intron-1 region using species-specific primers

• Analyze fragment sizes using standard agarose gel electrophoresis

• Compare banding patterns with known standards from verified species

This methodology provides a simplified approach for distinguishing among Pelophylax species and can be adapted for AQPA gene analysis to ensure species authenticity.

What techniques can resolve contradictory results in AQPA sequence analysis?

When researchers encounter contradictory results in AQPA sequence analysis, multiple verification approaches should be employed:

• Restriction enzyme analysis: Using endonucleases such as Bme 1390I that recognize specific sites can help verify sequence identity. For instance, restriction at the CCTGG site has been used to differentiate Pelophylax species .

• Selective sequencing: Direct sequencing of the AQPA gene from multiple clones can resolve ambiguities and identify potential polymorphisms or sequencing errors.

• Cross-validation with nuclear and mitochondrial markers: Analysis of nuclear markers (such as SAI-1) alongside mitochondrial genes (such as ND2) provides complementary data that can resolve contradictions .

When discrepancies occur, researchers should systematically document all variables including DNA extraction methods, PCR conditions, and sequencing platforms to identify potential sources of error.

How does the heterologous expression of AQPA compare with other aquaporin production systems?

The heterologous expression of Pelophylax esculentus AQPA in E. coli represents one approach among various systems used for aquaporin production. Comparative studies on human aquaporins have demonstrated that yeast systems like Pichia pastoris can yield exceptional results for some aquaporin isoforms while being less effective for others .

For researchers working with AQPA, this comparative data suggests that optimization strategies successful with human aquaporins could potentially be adapted to enhance AQPA production. These might include:

• Testing multiple expression hosts in parallel

• Optimizing induction conditions and expression parameters

• Developing strain-specific purification protocols

What structural modifications of AQPA can enhance water permeability or selectivity?

Advanced research on aquaporins has shown that strategic modifications to protein structure can alter functional properties. For AQPA research, potential approaches include:

• Site-directed mutagenesis of key residues in the NPA motifs and aromatic/arginine (ar/R) selectivity filter regions to alter pore size and selectivity

• Chimeric constructs combining domains from AQPA with those from other aquaporins to investigate domain-specific functions

• Post-translational modification sites identification and manipulation to study regulatory mechanisms

These structural modifications should be designed based on comparative analysis with well-characterized aquaporins and conducted using rigorous experimental controls to validate the resulting functional changes.

How can researchers overcome aggregation issues during recombinant AQPA production?

Membrane proteins like AQPA are prone to aggregation during recombinant production. To overcome this challenge, researchers should consider implementing these methodological adjustments:

• Optimized solubilization conditions: Testing various detergents (DDM, OG, LDAO) at different concentrations to identify optimal solubilization parameters

• Expression temperature modulation: Lowering expression temperature to 18-25°C can reduce aggregation by slowing protein synthesis and allowing proper folding

• Co-expression with chaperones: Molecular chaperones can assist in proper folding and prevent aggregation

For reconstitution of lyophilized AQPA powder, brief centrifugation prior to opening is recommended to bring contents to the bottom of the vial, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

What are the critical quality control parameters for ensuring recombinant AQPA functionality?

To ensure recombinant AQPA retains its native functionality, researchers should implement these quality control measures:

• Purity assessment: SDS-PAGE analysis confirming >90% purity

• Structural integrity verification: Circular dichroism spectroscopy to confirm proper secondary structure

• Functional assays: Water transport measurements in reconstituted proteoliposomes or cell-based systems

• Thermal stability analysis: Differential scanning calorimetry to assess protein stability under various conditions

• Oligomeric state determination: Size-exclusion chromatography coupled with multi-angle light scattering to verify the tetrameric assembly typical of functional aquaporins

Implementing these quality control parameters systematically will ensure reliable and reproducible results in AQPA research.