Recombinant Rana esculenta Cannabinoid receptor 1 (cnr1)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant cnr1 is synthesized using multiple platforms:

Expression SystemHostPurityApplications
E. coliBacterial≥85%Structural studies, ELISA
BaculovirusInsect cells≥85%Functional assays
Mammalian cellsHEK293≥85%Drug screening

Source:

Key product variants include:

  • CSB-CF657029RAW: Full-length protein expressed in E. coli .

  • CSB-MP657029RAW1: Partial sequence with mammalian cell-based post-translational modifications .

Binding Activity (ELISA)

  • EC₅₀: 41.72–63.54 ng/mL when interacting with anti-CNR1 antibodies .

  • Ligand specificity: Binds Δ⁹-tetrahydrocannabinol (THC) analogs and endogenous endocannabinoids like anandamide .

Physiological Relevance in Frogs

  • Reproductive regulation: Testicular cnr1 expression fluctuates seasonally, peaking during breeding periods .

  • CNS modulation: Exhibits distinct mRNA splicing patterns in brain vs. testis, suggesting tissue-specific roles .

Research Applications

  • Comparative endocannabinoid studies: Used to investigate evolutionary conservation of cannabinoid signaling across vertebrates .

  • Reproductive biology: Serves as a model for understanding cannabinoid effects on amphibian spermatogenesis and hormone regulation .

  • Drug discovery: Facilitates screening of CB1-targeted therapeutics due to structural homology with mammalian receptors .

Challenges and Future Directions

  • Structural limitations: Lack of native glycosylation in prokaryotic systems may affect ligand-binding kinetics .

  • Research gaps: Limited in vivo data on cnr1’s role in amphibian immunity and metabolism .

  • Therapeutic potential: Exploration of cnr1 modulators for addressing metabolic disorders or inflammatory conditions in non-mammalian models .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please specify them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag requirements, please communicate them to us, and we will prioritize the development of the specified tag.
Synonyms
cnr1; Cannabinoid receptor 1; CB-R; CB1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-462
Protein Length
full length protein
Species
Pelophylax esculentus (Edible frog) (Rana esculenta)
Target Names
Target Protein Sequence
MKSVLDGLADTTFRTITTDLLYMGPNEVQYEDTKSDLSKLGYYPQKLPLSSYQEKIIDGQ STLHLDSFNATEFYNKSITTFKDGDGNIQCGNNFMDMECFMILTPSQQLVIAALSITLGT FTVLENMLVLCVIFQSRTLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRIDSPNV FLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLSYKRIVTRTKAVIAFCMMWTIAIVIA VLPLLGWNCKKLKSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHHHAVRM LQRGTQKSIIVHTSEDGKVHITRPDQTRMDIRLAKTLVLILVVLIICWGPLLAIMVYDVF GKMNKTVKTVFAFCCMLCLLNSTVNPIIYALRSKDLRSAFCSMFPNCEGTAQPLDNSMES DGQNRHAHNSNVHRAAESCIKSTVKIAKVTMSVSTDTSAEAV
Uniprot No.

Target Background

Function
Cannabinoid receptor 1 (cnr1) is a G-protein coupled receptor for cannabinoids. It mediates numerous cannabinoid-induced effects in the central nervous system (CNS) and peripheral tissues. Cnr1 regulates cellular respiration and energy production in response to cannabinoids. Signaling typically involves a reduction in cyclic AMP. This receptor may also play a role in controlling reproductive function.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Mitochondrion outer membrane. Cell projection, axon. Cell junction, synapse, presynapse.
Tissue Specificity
Widely expressed, with high levels in the CNS and lower in testis, kidney, liver, ovary, muscle, heart, spleen and pituitary.

Q&A

What is Rana esculenta Cannabinoid receptor 1 (CNR1) and how does it compare to mammalian homologs?

Rana esculenta Cannabinoid receptor 1 (CNR1) is a G-protein coupled receptor expressed in the anuran amphibian frog species Rana esculenta. The receptor is part of the endocannabinoid system, which is phylogenetically conserved across vertebrates. The frog CNR1 encodes a protein of 462 amino acids (FCNR1) that exhibits all the properties of a membrane G-coupled receptor . Comparative analysis reveals that FCNR1 shares amino acid identity ranging from 61.9% to 88.1% with other vertebrate CNR1 proteins, with critical functional domains being conserved in the frog receptor . This conservation suggests fundamental similarities in the endocannabinoid signaling mechanism across vertebrate evolution, despite the evolutionary distance between amphibians and mammals. The receptor functions in a similar manner to mammalian counterparts, mediating responses to endogenous cannabinoids and playing roles in physiological processes including reproduction and central nervous system function .

What analytical techniques are most effective for studying CNR1 structure in Rana esculenta?

For structural analysis of Rana esculenta CNR1, researchers have successfully employed multiple complementary techniques. RT-PCR has proven effective for initial characterization of CNR1 mRNA expression profiles across various tissues . For more detailed structural analysis, cloning of the CNR1 cDNA followed by nucleotide sequencing has allowed determination of the complete reading frame and amino acid sequence . Comparative bioinformatics approaches, including sequence alignment with CNR1 proteins from other vertebrates, help identify conserved domains essential for receptor functionality. For genomic analysis, standard DNA extraction followed by PCR amplification and sequencing of the CNR1 gene provides insights into genomic organization. RNA folding prediction software can be applied to assess how nucleotide differences affect the secondary structure of CNR1 mRNA . These approaches should be complemented with protein expression and purification methods to enable further structural characterization through techniques such as Western blotting with specific antibodies or recombinant protein production systems .

What is the tissue distribution pattern of CNR1 in Rana esculenta and how can researchers effectively map this expression?

CNR1 in Rana esculenta exhibits a widespread tissue distribution pattern. RT-PCR analysis has demonstrated strong expression in the central nervous system (CNS), with significant expression also detected in testis, kidney, liver, ovary, muscle, heart, spleen, and pituitary . This broad distribution suggests multiple physiological roles beyond neuronal function. For effective expression mapping, quantitative RT-PCR remains the gold standard, allowing precise measurement of CNR1 mRNA levels across different tissues. Tissue collection should be timed to account for seasonal variations, particularly when studying reproductive tissues. Immunohistochemistry with validated antibodies against conserved epitopes of CNR1 can provide cellular and subcellular localization information. For temporal expression patterns, researchers should design studies that sample tissues at multiple timepoints throughout the annual reproductive cycle, as significant fluctuations have been documented particularly in the CNS and testis . In situ hybridization offers complementary data on cellular expression patterns, especially useful for heterogeneous tissues like the brain where region-specific expression may have functional significance.

How does CNR1 expression in Rana esculenta vary during the annual reproductive cycle?

CNR1 expression in Rana esculenta demonstrates notable fluctuations throughout the annual reproductive cycle, with tissue-specific patterns. In the testis, CNR1 is poorly expressed during winter stasis of spermatogenesis but increases significantly during the breeding season and resumption period . This temporal pattern suggests a regulatory role for endocannabinoid signaling in male reproductive function. Interestingly, the expression profile in the central nervous system shows a pattern that does not match that observed in the testis . Particularly in the diencephalon, the brain region primarily involved in reproductive function regulation, CNR1 expression patterns fluctuate throughout the reproductive cycle in a manner distinct from gonadal expression . Additionally, fluctuations in CNR1 expression are observed in isolated encephalic areas and the spinal cord throughout the reproductive cycle. This temporal and spatial variation in expression patterns strongly suggests that the endocannabinoid system, acting through CNR1, plays a coordinated but tissue-specific role in regulating reproductive functions in this amphibian species . Researchers investigating these patterns should employ time-series sampling strategies covering pre-breeding, breeding, and post-breeding periods.

What experimental approaches are recommended for investigating CNR1 gene expression regulation in amphibians?

For comprehensive investigation of CNR1 gene expression regulation in amphibians, a multi-faceted experimental approach is recommended. Promoter analysis through reporter gene assays can identify key regulatory elements controlling basal and tissue-specific CNR1 expression. Chromatin immunoprecipitation (ChIP) assays can determine transcription factors binding to the CNR1 promoter region under different physiological conditions. For epigenetic regulation, bisulfite sequencing and methylation-specific PCR can assess DNA methylation status of the CNR1 promoter, while histone modification patterns can be analyzed through ChIP using antibodies against specific histone marks. CRISPR/Cas9-mediated genomic editing allows functional validation of putative regulatory elements through targeted mutations. For post-transcriptional regulation, RNA immunoprecipitation can identify RNA-binding proteins interacting with CNR1 mRNA. MicroRNA involvement can be assessed through bioinformatic prediction followed by luciferase reporter assays. Alternative splicing patterns should be investigated using RT-PCR with primers spanning potential splice junctions. For hormonal regulation, particularly relevant given the reproductive cycle fluctuations, ex vivo tissue culture systems treated with various hormones can reveal direct effects on CNR1 expression .

What expression systems are most suitable for producing functional recombinant Rana esculenta CNR1 protein?

For functional recombinant Rana esculenta CNR1 protein production, several expression systems can be considered, each with distinct advantages. Mammalian expression systems (particularly HEK293 or CHO cells) represent the preferred approach for membrane-bound G-protein coupled receptors like CNR1, as they provide proper folding, post-translational modifications, and trafficking to the plasma membrane. For amphibian proteins specifically, Xenopus oocytes offer an expression system phylogenetically closer to Rana esculenta, potentially providing a more native environment for proper folding and function. Insect cell systems (Sf9, Sf21, or High Five cells) using baculovirus vectors represent another viable option, particularly for obtaining higher yields of functional membrane proteins. Wheat germ cell-free expression systems have been successfully used for human CNR1 and may be adapted for the amphibian receptor when rapid expression is needed. For structural studies requiring larger quantities, yeast systems (Pichia pastoris or Saccharomyces cerevisiae) engineered for membrane protein expression can be considered. Regardless of the chosen system, expression constructs should include affinity tags (His6, FLAG, etc.) for purification while considering their potential impact on receptor functionality. Expression should be verified through Western blotting and functionality assessed through ligand binding assays.

What purification and characterization methods yield the highest quality recombinant CNR1 protein for functional studies?

Obtaining high-quality recombinant CNR1 protein for functional studies requires optimized purification and characterization methods. For membrane protein purification, initial solubilization with appropriate detergents (DDM, LMNG, or digitonin) that maintain CNR1 structure and function is critical. Affinity chromatography using tags incorporated into the expression construct (His6, FLAG) provides the initial purification step, followed by size exclusion chromatography to remove aggregates and ensure homogeneity. For functional characterization, ligand binding assays using radiolabeled or fluorescent cannabinoid ligands can verify receptor activity. G-protein coupling can be assessed through GTPγS binding assays or bioluminescence resonance energy transfer (BRET) assays. Structural integrity should be verified through circular dichroism spectroscopy to analyze secondary structure content, with thermal stability assays providing information on protein stability. For detailed structural characterization, cryogenic electron microscopy has emerged as the preferred method for membrane proteins like GPCRs. Functional reconstitution into proteoliposomes or nanodiscs can provide a more native-like membrane environment for activity assays. All characterization should include comparison to known CNR1 properties from other species to validate proper folding and function .

How does Rana esculenta CNR1 compare structurally and functionally to CNR1 receptors in other vertebrate species?

Comparative analysis of Rana esculenta CNR1 with other vertebrate species reveals both conservation and divergence. Structurally, the frog CNR1 encodes a protein of 462 amino acids with nucleotide identity ranging from 62.6% to 81.9% across vertebrates . The amino acid sequence shows identity ranging from 61.9% to 88.1% when aligned with CNR1 proteins from other vertebrates . Critical domains necessary for CNR1 functionality are conserved in the frog, suggesting preservation of core signaling mechanisms despite evolutionary distance. Like its mammalian counterparts, the frog CNR1 maintains all the structural properties characteristic of a membrane G-coupled receptor . The receptor contains the typical seven-transmembrane domain structure with extracellular N-terminal domain and intracellular C-terminal domain that characterizes cannabinoid receptors across species . Functionally, the frog CNR1 appears to participate in similar physiological processes as in mammals, including central nervous system functions and reproductive regulation . The conservation of CNR1 across vertebrate lineages, from fish to amphibians to mammals, indicates the fundamental importance of the endocannabinoid system throughout vertebrate evolution and suggests that amphibian models like Rana esculenta can provide valuable insights into conserved mechanisms of cannabinoid signaling.

What insights does amphibian CNR1 provide into the evolution of the endocannabinoid system?

Analysis of Rana esculenta CNR1 offers valuable insights into endocannabinoid system evolution across vertebrate lineages. The presence of functional CNR1 in amphibians, with significant sequence homology to both fish and mammalian receptors, supports the hypothesis that the endocannabinoid system emerged early in vertebrate evolution and has been maintained through strong selective pressure. The conservation of critical domains necessary for CNR1 functionality across species suggests fundamental signaling mechanisms have remained largely unchanged despite hundreds of millions of years of evolutionary divergence . The broad tissue distribution pattern observed in Rana esculenta, including strong expression in the CNS, testis, kidney, liver, ovary, and other tissues, indicates that the multifunctional nature of the endocannabinoid system also represents an ancestral trait . Of particular evolutionary interest are the nucleotide differences observed between genomic DNA and cDNA sequences in Rana esculenta CNR1. The fact that similar phenomena occur in species across the vertebrate tree (humans, rats, zebrafish, and pufferfish) suggests these post-transcriptional modifications may represent an ancient regulatory mechanism in the endocannabinoid system . Studying CNR1 in amphibians therefore provides a valuable evolutionary perspective, representing a transitional stage between aquatic and terrestrial vertebrates and offering insights into both conserved and divergent features of this receptor system.

What roles does CNR1 play in amphibian reproductive physiology?

CNR1 appears to play significant roles in amphibian reproductive physiology, as evidenced by its expression patterns in reproductive tissues and fluctuations throughout the annual sexual cycle. In Rana esculenta, CNR1 is expressed in both male and female reproductive organs, including testis and ovary . In the testis specifically, CNR1 expression follows a distinct temporal pattern, being poorly expressed during the winter stasis of spermatogenesis but rising significantly during the breeding season and resumption period . This temporal correlation strongly suggests involvement in regulating spermatogenesis. CNR1 is also expressed in the diencephalon, the encephalic area primarily involved in controlling reproductive functions, with expression patterns that fluctuate during the reproductive cycle . This brain-gonad relationship indicates a potential role for CNR1 in the hypothalamic-pituitary-gonadal axis that regulates reproduction. The mismatch between CNR1 expression patterns in the brain versus testis suggests tissue-specific regulation and potentially different roles in central versus peripheral reproductive functions . The collective evidence strongly suggests that endocannabinoids, acting through CNR1, participate in the complex neuroendocrine regulation of amphibian reproduction, potentially influencing processes such as gametogenesis, steroidogenesis, and reproductive behaviors through both central and peripheral mechanisms.

What experimental approaches are most effective for studying CNR1 function in Rana esculenta tissues?

Investigating CNR1 function in Rana esculenta requires specialized experimental approaches adapted for amphibian tissues. Pharmacological studies using selective CNR1 agonists (e.g., ACEA, WIN55,212-2) and antagonists (e.g., SR141716A) can reveal receptor-mediated effects in various tissues. Ex vivo organ culture systems are particularly valuable for reproductive tissues, allowing manipulation of endocannabinoid signaling while maintaining tissue architecture. For electrophysiological studies, patch-clamp recordings from neurons in brain slices can assess CNR1-mediated effects on neuronal activity, particularly in the diencephalon where CNR1 is expressed and involved in reproductive control . Calcium imaging in primary cell cultures can reveal CNR1-mediated signaling dynamics. For in vivo approaches, osmotic minipumps can deliver cannabinoid compounds over extended periods to study chronic effects on reproductive parameters. Seasonal studies are essential given the fluctuating expression patterns, with experiments timed to winter stasis, breeding season, and resumption periods . CRISPR/Cas9-mediated gene editing, though technically challenging in amphibians, offers potential for creating CNR1 knockout or knockin models. For signaling pathway elucidation, Western blotting for phosphorylated signaling proteins (ERK, Akt) following CNR1 activation can map downstream effects. Importantly, all studies should account for sex differences and seasonal variations to capture the full spectrum of CNR1 functions in amphibian physiology.

What are the key technical challenges in working with Rana esculenta CNR1 and how can they be addressed?

Working with Rana esculenta CNR1 presents several technical challenges that require specialized approaches. Seasonal availability of research specimens represents a significant limitation, as CNR1 expression varies throughout the annual reproductive cycle . Researchers should either maintain laboratory colonies under controlled environmental conditions or carefully plan experiments around seasonal availability. Antibody cross-reactivity presents another challenge, as commercially available antibodies are typically raised against mammalian CNR1 epitopes. This can be addressed by either developing custom antibodies against Rana esculenta-specific epitopes or validating existing antibodies using positive controls (tissues with known high CNR1 expression) and negative controls (tissues from CNR1 knockout specimens or with antibody pre-absorption). The differences between genomic and cDNA sequences necessitate careful primer design for PCR-based applications, with primers designed to accommodate potential nucleotide variations. For functional studies, the pharmacological profile of amphibian CNR1 may differ from mammalian receptors, requiring careful dose-response studies with cannabinoid ligands to establish appropriate working concentrations. Tissue-specific expression patterns mean that researchers must carefully select tissues based on experimental objectives, with the brain and testis offering the most well-characterized CNR1 expression. Finally, the lack of established Rana esculenta cell lines necessitates either primary cell culture optimization or heterologous expression systems when studying the receptor in isolation.

How can researchers effectively control for experimental variables when studying seasonal variations in CNR1 expression?

When investigating seasonal variations in CNR1 expression in Rana esculenta, controlling experimental variables is crucial for obtaining reliable and reproducible results. Environmental parameters including temperature, photoperiod, and humidity should be carefully monitored and recorded, as these factors directly influence amphibian reproductive cycles. Standardizing animal collection methods is essential, with detailed documentation of collection sites, times, and environmental conditions. For laboratory-maintained specimens, implement controlled environmental chambers that can simulate seasonal changes to standardize the reproductive cycle. Age and size matching of specimens is critical, as both factors can influence CNR1 expression independently of seasonal effects. Carefully stage animals according to reproductive status using established criteria (histological examination of gonadal tissues, hormone levels) rather than relying solely on calendar dates. Include multiple reference genes for normalization in qPCR studies of CNR1 expression, selecting genes that maintain stable expression across seasonal changes. Simultaneous measurement of relevant hormones (testosterone, estradiol, gonadotropins) provides context for interpreting CNR1 expression changes . Design longitudinal studies where possible, using minimally invasive sampling techniques to track changes in the same individuals over time. Finally, proper statistical approaches for time-series data analysis are essential, including repeated measures designs and circular statistics when appropriate for cyclical biological phenomena.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.