Recombinant Ranunculus macranthus ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence

The 247-residue sequence begins with MNVLPCSVNTLKGLYDISGVEVGQHFYWQIGGFQVHAQVLITSWFVIAILLGSAIIAVRN... and features:

  • Transmembrane domains: Predicted via hydrophobic regions (e.g., residues 50–70 and 90–110) .

  • Functional motifs: Conserved ATP synthase rotary machinery components, including proton-binding sites .

Gene Context in Chloroplast Genomes

Comparative plastome analyses of Ranunculaceae species reveal that atpI is part of a conserved ATP synthase gene cluster (atpA, atpB, atpE, atpF, atpH, atpI) in the large single-copy (LSC) region . Unlike rps16 or rpl32, which show nuclear transfer events in related genera like Aconitum, atpI remains chloroplast-encoded, highlighting its essential role in photosynthesis .

Role in ATP Synthase Complex

  • Proton channel formation: Subunit a facilitates proton flow through the F0 sector, driving ATP synthesis in the F1 sector .

  • Structural stability: Interactions with subunit b (atpF) stabilize the F0-F1 interface, as observed in homologous systems .

Evolutionary Conservation

Phylogenomic studies indicate high sequence conservation (>95% identity) of atpI across Ranunculaceae, including Pulsatilla and Clematis . This contrasts with variable regions like rps16, which exhibit lineage-specific losses or nuclear transfers .

Biochemical Studies

  • Enzyme kinetics: Used to measure proton-coupled ATP hydrolysis rates in reconstituted lipid bilayers .

  • Antibody production: His-tagged protein enables antibody generation for immunolocalization in chloroplast membranes .

Phylogenetic Context

The chloroplast genome of Ranunculus macranthus shares six locally collinear blocks (LCBs) with Aconitum and Clematis, including the atpI-containing LSC region . Despite large-scale rearrangements in other genes (e.g., rps16), atpI remains syntenic, underscoring its functional indispensability .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Ranunculus macranthus (Large buttercup)
Target Names
atpI
Target Protein Sequence
MNVLPCSVNTLKGLYDISGVEVGQHFYWQIGGFQVHAQVLITSWFVIAILLGSAIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a (atpI) plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic location of the atpI gene in Ranunculus macranthus?

The atpI gene in Ranunculus macranthus is located in the Large Single Copy (LSC) region of the chloroplast genome. Based on comparative genomic analysis of Ranunculus species, the atpI gene is positioned downstream of the atpH and atpF genes in the chloroplast genome. Specifically, in R. macranthus, the atpH gene is located between the atpF and atpI genes within a 1.3 kb LSC region, which is consistent with the genomic organization observed in most Ranunculus species .

This genomic arrangement is significant for chloroplast evolution studies and can be verified through chloroplast genome sequencing and annotation processes. Researchers studying this gene should note that in some Ranunculus species like R. austro-oreganus and R. occidentalis, gene rearrangements have occurred due to expansion and contraction of the Inverted Repeat (IR) and Small Single Copy (SSC) regions, which might affect comparative analyses across the genus.

How does the atpI subunit contribute to ATP synthase function in chloroplasts?

The atpI subunit (also known as subunit a) is a critical component of the Fo portion of chloroplast ATP synthase that remains embedded in the thylakoid membrane. This subunit forms part of the proton channel and works in concert with the c-ring to facilitate proton translocation across the thylakoid membrane. When protons move through this channel along the electrochemical gradient established during photosynthesis, they drive the rotation of the c-ring .

Methodologically, the function of atpI can be studied through:

  • Site-directed mutagenesis to identify essential amino acid residues

  • Recombinant expression and reconstitution experiments

  • Structural analysis using cryo-electron microscopy

  • Proton translocation assays with reconstituted proteoliposomes

The mechanical energy from this rotation is transferred via the γ-subunit to the F1 portion, where it drives conformational changes in the catalytic sites, resulting in ATP synthesis. For each complete rotation of the c-ring, three ATP molecules are synthesized, with the exact proton:ATP ratio depending on the number of c-subunits in the ring .

What expression systems are recommended for recombinant production of chloroplastic atpI?

Based on recombinant approaches used for other ATP synthase subunits, Escherichia coli expression systems are recommended for the recombinant production of chloroplastic atpI from Ranunculus macranthus. When designing an expression system, consider the following methodological approaches:

Expression SystemAdvantagesChallengesRecommended Tags
E. coli BL21(DE3)High yield, well-established protocolsPotential toxicity, inclusion body formationMBP, SUMO, His6
E. coli C41/C43Specialized for membrane proteinsLower yield than BL21His6, FLAG
Cell-free systemAvoids toxicity issuesHigher cost, lower yieldHis6, Strep-tag

For optimal expression, fusion partners like Maltose-Binding Protein (MBP) can significantly improve solubility and yield, as demonstrated with the c-subunit of spinach chloroplast ATP synthase . The expression construct should be designed with appropriate protease cleavage sites to remove fusion tags after purification.

Codon optimization for E. coli is recommended, as plant chloroplast genes may contain codons that are rare in E. coli. Temperature, IPTG concentration, and induction time should be optimized to prevent inclusion body formation. For membrane proteins like atpI, detergent screening is essential for maintaining proper folding during purification .

How can experimental design address challenges in studying atpI-specific functions versus whole ATP synthase complex?

Studying the specific functions of atpI presents significant challenges due to its integral role within the ATP synthase complex. A well-designed experimental approach should incorporate the following methodological strategies:

When designing these experiments, researchers should include appropriate randomization and replication to ensure statistical validity, and carefully document all experimental conditions to enable reproducibility .

What evolutionary adaptations in Ranunculus macranthus atpI might explain its functionality in varying environmental conditions?

Evolutionary adaptations in R. macranthus atpI can be investigated through comparative genomic and functional analyses. The following methodological approach is recommended:

  • Comparative Sequence Analysis

    • Perform multiple sequence alignments of atpI across Ranunculus species and other plant genera

    • Identify conserved domains versus variable regions that might indicate functional adaptation

    • Conduct selection pressure analysis using dN/dS ratios to identify positively selected sites

  • Structure-Function Correlation

    • Map amino acid variations onto predicted protein structures

    • Focus on residues within proton channels and interface regions with other subunits

    • Several genes in Ranunculus, including rpoA, have shown high posterior probability of codon sites under positive selection, suggesting potential adaptation mechanisms

  • Environmental Correlation Studies

    • Design experiments testing ATP synthase efficiency under various temperature, pH, and salt conditions

    • Compare performance metrics between recombinant atpI from R. macranthus and related species from different habitats

    • Quantify thermal stability and pH optimum differences that correlate with ecological niches

This research would benefit from including molecular dynamics simulations to predict how identified variations might affect proton channeling efficiency and subunit interactions under different environmental stressors.

How can contradictory data between in vitro and in vivo studies of recombinant atpI be reconciled?

Reconciling contradictory data between in vitro and in vivo studies requires systematic investigation of methodological differences and biological context. Researchers should implement the following approach:

  • Systematic Comparison Framework

    ParameterIn Vitro ConditionsIn Vivo ConditionsPotential Impact on Results
    Membrane environmentArtificial lipidsNative thylakoidAltered protein conformation
    Protein interactionsLimited/controlledComplete interactomeMissing regulatory effects
    Post-translational modificationsAbsent/controlledNaturally occurringFunctional regulation differences
    Proton gradientArtificially imposedDynamically maintainedKinetic parameter variations
  • Integration of Multiple Methodologies

    • Apply complementary approaches (e.g., biochemical assays, fluorescence resonance energy transfer, in-organello studies)

    • Validate findings across different experimental platforms

    • Consider the metabolic model approach used in systems biology to identify false essential or false dispensable predictions

  • Targeted Validation Experiments

    • Design experiments specifically to test hypotheses explaining discrepancies

    • Gradually increase system complexity to identify threshold of contradictory behavior

    • Implement time-resolved studies to capture dynamic behaviors that might be missed in endpoint analyses

  • Mathematical Modeling

    • Develop models incorporating both in vitro and in vivo parameters

    • Use sensitivity analysis to identify key variables causing discrepancies

    • Iteratively refine models with experimental data to improve predictive power

This approach has successfully resolved discrepancies in other membrane protein studies and can be particularly valuable for ATP synthase research where the complex structure-function relationship is highly dependent on the membrane environment.

What are the optimal purification strategies for maintaining structural integrity of recombinant atpI?

Purification of membrane proteins like atpI requires specialized approaches to maintain structural integrity. Based on successful protocols for other ATP synthase subunits, the following methodological strategy is recommended:

  • Detergent Screening and Optimization

    Detergent ClassExamplesAdvantagesLimitations
    Mild non-ionicDDM, LMNGPreserves native structureLower extraction efficiency
    Zwitter-ionicLDAO, FC-12Higher extraction efficiencyMay destabilize some proteins
    Peptide-basedSMA, amphipolsExtracts native lipid environmentLimited compatibility with some techniques

    The optimal detergent should be systematically determined through stability assays and functional tests.

  • Affinity Chromatography Optimization

    • Implement a two-step purification strategy using affinity tags positioned to minimize interference with protein folding

    • The MBP fusion tag has shown significant success with ATP synthase subunits and should be considered as a primary option

    • Include detergent screening in the chromatography buffers to prevent aggregation

  • Quality Control Measures

    • Verify structural integrity through circular dichroism to confirm alpha-helical content

    • Employ size-exclusion chromatography with multi-angle light scattering to assess oligomeric state

    • Validate functionality through reconstitution assays measuring proton translocation

  • Alternative Approaches

    • Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) to maintain native lipid environment

    • Implement on-column detergent exchange during purification to minimize exposure time to harsh detergents

    • Explore cryo-protective additives for long-term storage

Researchers should document detailed buffer compositions, temperatures, and handling procedures to ensure reproducibility, as minor variations can significantly impact membrane protein stability.

How does the interaction between atpI and other ATP synthase subunits differ in Ranunculus macranthus compared to model plant species?

Understanding subunit interactions specific to R. macranthus requires comparative structural and functional analyses:

This comparative approach can reveal unique adaptations in the R. macranthus ATP synthase complex that might reflect environmental or metabolic specializations of this species.

What controls should be included when assessing recombinant atpI integration into artificial membrane systems?

When designing experiments to assess recombinant atpI integration into artificial membranes, the following comprehensive control system should be implemented:

  • Negative Controls

    • Empty liposomes without protein

    • Liposomes with irrelevant membrane protein of similar size/topology

    • Heat-denatured atpI preparation

    • These controls account for non-specific effects and background signals

  • Positive Controls

    • Native ATP synthase complex isolated from chloroplasts

    • Well-characterized related subunit (if available)

    • These provide reference points for successful integration and function

  • Integration Verification Controls

    • Protease protection assays with/without membrane permeabilization

    • Fluorescence-based orientation assays using labeled domains

    • Density gradient centrifugation to separate integrated vs. aggregated protein

  • Functional Validation Controls

    • Proton translocation assays with controlled gradients

    • ATP synthesis/hydrolysis measurements with specific inhibitors

    • Comparison between different membrane compositions

This experimental design follows the true experimental research design principles by incorporating control groups, systematic variable manipulation, and randomization to control for extraneous variables . Documentation of all experimental conditions, including lipid composition, buffer systems, temperature, and incubation times is essential for reproducibility.

How can researchers optimize codon usage for heterologous expression of Ranunculus macranthus atpI?

Codon optimization is critical for efficient heterologous expression of plant chloroplast genes in bacterial systems. The following methodological approach is recommended:

This systematic approach can significantly improve heterologous expression of challenging membrane proteins like atpI, potentially increasing yield by orders of magnitude compared to non-optimized sequences.

What bioinformatic approaches can identify potential post-translational modifications in atpI that might affect recombinant protein function?

Post-translational modifications (PTMs) can significantly impact protein function but are often lost in recombinant systems. A comprehensive bioinformatic workflow to identify potential PTMs includes:

  • Sequence-Based Prediction

    • Employ multiple PTM prediction algorithms (NetPhos, GPS, ModPred)

    • Focus on evolutionarily conserved sites across Ranunculus species

    • Compare with experimentally verified PTMs in related proteins

  • Structural Context Analysis

    • Map predicted PTM sites onto structural models

    • Evaluate accessibility of sites to modifying enzymes

    • Assess proximity to functional domains and interaction interfaces

  • Evolutionary Conservation Assessment

    • Perform phylogenetic analysis of modification sites

    • Calculate site-specific evolutionary rates

    • Identify coevolving residues that might interact with modified sites

  • Integration with Experimental Data

    • Compare predictions with mass spectrometry data if available

    • Validate key predictions using site-directed mutagenesis

    • Test functional impact through activity assays

Based on the comparative analysis of ATP synthase components, researchers should pay particular attention to residues that show evidence of positive selection, as identified in other ATP synthase subunits like rpoA . These sites often correlate with functional adaptations and may be targets for regulatory PTMs.

How can researchers address protein aggregation issues during recombinant atpI expression?

Membrane protein aggregation is a common challenge that requires systematic troubleshooting. The following methodological framework can help researchers address this issue:

  • Preventive Strategies During Expression

    ParameterOptimization StrategyRationale
    TemperatureLower to 16-20°CReduces translation rate allowing proper folding
    InductionUse lower IPTG concentrations (0.1-0.5 mM)Prevents overwhelming the folding machinery
    Growth mediaSupplement with glycerol, sucroseOsmolytes stabilize protein structure
    Co-expressionAdd molecular chaperones (GroEL/ES, DnaK)Assists proper folding
  • Solubilization Optimization

    • Perform systematic detergent screening with different classes and concentrations

    • Test mixed micelle approaches (combining mild and stronger detergents)

    • Explore addition of specific lipids that might stabilize the native structure

    • Implement stepwise solubilization protocols with increasing detergent concentrations

  • Fusion Tag Strategies

    • Test MBP, SUMO, or NusA tags that significantly enhance solubility

    • Position tags to minimize interference with transmembrane domains

    • Consider dual tagging strategies for improved purification and solubility

    • The MBP fusion approach has been successfully applied to chloroplast ATP synthase subunits

  • Refolding Approaches

    • Develop protocols for refolding from inclusion bodies if necessary

    • Implement gradual dialysis to remove denaturing agents

    • Test on-column refolding during purification

    • Include stabilizing additives like glycerol or arginine

This systematic approach should be documented with detailed protocols, allowing for reproducible optimization and sharing of successful methods with the research community.

What are the most likely causes of contradictory results when comparing native and recombinant atpI function?

Contradictory results between native and recombinant atpI can stem from multiple factors that should be systematically investigated:

  • Structural Differences

    • Absence of post-translational modifications in recombinant systems

    • Altered folding due to different membrane environments

    • Missing lipid interactions that stabilize certain conformations

    • Potential impact of purification conditions on protein structure

  • Functional Context Variations

    • Isolation from the complete ATP synthase complex

    • Altered interactions with other subunits

    • Differences in proton gradient establishment and maintenance

    • Recombinant expression may lead to functional redundancy not present in native systems, similar to issues identified in metabolic models

  • Methodological Variations

    • Different assay conditions between native and recombinant studies

    • Variations in membrane composition for reconstitution experiments

    • Detection method sensitivities and artifacts

    • Experimental design issues such as inadequate controls or statistical power

  • Systematic Investigation Approach

    • Design paired experiments testing both preparations under identical conditions

    • Implement reconstitution of recombinant atpI into native membranes

    • Perform stepwise addition of other ATP synthase components

    • Develop hybrid systems with mixed native/recombinant components to pinpoint discrepancy sources

Understanding these variations is crucial for accurate interpretation of experimental results and development of more physiologically relevant recombinant systems.

How can gene editing technologies be applied to study atpI function in Ranunculus macranthus?

Gene editing technologies offer powerful approaches to study chloroplast genes like atpI. A methodological framework for their application includes:

  • CRISPR/Cas Systems for Chloroplast Genome Editing

    • Design chloroplast-specific CRISPR/Cas systems with appropriate promoters and transit peptides

    • Optimize guide RNA design for atpI-specific targeting

    • Implement precise editing strategies (point mutations, domain swapping)

    • Establish selection markers for transformed chloroplasts

  • Transplastomic Approaches

    • Develop Ranunculus-specific chloroplast transformation protocols

    • Design constructs for homologous recombination to modify atpI

    • Create atpI variants with altered functional domains

    • Implement inducible or tissue-specific expression systems

  • Functional Validation Strategies

    • Measure ATP synthesis rates in isolated chloroplasts

    • Assess proton gradient formation using fluorescent probes

    • Analyze plant growth and photosynthetic parameters

    • Perform detailed biochemical characterization of ATP synthase complex

  • Complementation with Recombinant Variants

    • Express wild-type or modified atpI in mutant backgrounds

    • Compare functional restoration with different variants

    • Use competition assays to assess relative fitness

    • This approach is similar to the metabolic model refinement process where gene essentiality inconsistencies guide model correction

These technologies can provide direct evidence for atpI function within its native context while allowing precise manipulation to test specific hypotheses about structure-function relationships.

What are the critical parameters for successful reconstitution of recombinant atpI into liposomes?

Successful reconstitution of membrane proteins like atpI into liposomes requires careful optimization of multiple parameters:

  • Lipid Composition Optimization

    ComponentRecommended RangeFunctional Importance
    Phosphatidylcholine (PC)40-60%Provides bilayer stability
    Phosphatidylethanolamine (PE)20-30%Facilitates protein folding
    Phosphatidylglycerol (PG)10-20%Mimics thylakoid membrane charge
    Cardiolipin5-10%Critical for ATP synthase function
    Cholesterol0-5%Modulates membrane fluidity
  • Protein-to-Lipid Ratio

    • Test ratios ranging from 1:50 to 1:2000 (w/w)

    • Optimize based on protein activity vs. incorporation efficiency

    • Consider functional oligomeric state requirements

    • Monitor with freeze-fracture electron microscopy or dynamic light scattering

  • Reconstitution Method Selection

    • Detergent removal techniques: compare dialysis, Bio-beads, cyclodextrin

    • Direct incorporation: test sonication, freeze-thaw, extrusion

    • Evaluate each method for incorporation efficiency and orientation control

    • Assess functional parameters post-reconstitution

  • Buffer Optimization

    • pH range testing (typically 6.5-8.0)

    • Ionic strength optimization (50-200 mM)

    • Addition of stabilizing agents (glycerol, sucrose)

    • Inclusion of ATP synthase substrates during reconstitution

This methodological approach requires systematic optimization with controlled experiments where each parameter is varied independently while monitoring both structural integrity and functional activity of the reconstituted protein.

How can researchers accurately determine the orientation of atpI in reconstituted membrane systems?

Determining membrane protein orientation is critical for functional studies. The following methodological approaches can be applied to atpI:

  • Antibody Accessibility Assays

    • Generate antibodies against domain-specific epitopes

    • Perform immunolabeling before and after membrane permeabilization

    • Quantify accessibility ratios to determine predominant orientation

    • Include controls with known orientation for comparison

  • Protease Protection Assays

    • Expose proteoliposomes to proteases with/without detergent

    • Analyze fragmentation patterns by SDS-PAGE and mass spectrometry

    • Map cleavage sites to protein topology model

    • Perform time-course experiments to identify exposed vs. protected domains

  • Fluorescence-Based Methods

    • Introduce site-specific fluorescent labels at key positions

    • Measure fluorescence quenching with membrane-impermeable quenchers

    • Perform FRET measurements with lipid-anchored fluorophores

    • Calculate orientation ratios based on fluorescence signals

  • Functional Assays

    • Design assays that depend on correct orientation (e.g., ATP synthesis vs. hydrolysis)

    • Create inside-out vs. right-side-out vesicle preparations for comparison

    • Use ionophores to equilibrate ion gradients and assess directional effects

    • Perform patch-clamp studies on larger proteoliposomes or GUVs

These complementary approaches should be combined to provide robust evidence for orientation determination, with statistical analysis of multiple independent preparations to ensure reliability.

What spectroscopic methods are most appropriate for structural characterization of recombinant atpI?

Membrane proteins like atpI require specialized spectroscopic approaches for structural characterization:

  • Circular Dichroism (CD) Spectroscopy

    • Provides secondary structure content (alpha-helix, beta-sheet)

    • Suitable for detergent-solubilized and reconstituted samples

    • Can monitor thermal stability and conformational changes

    • Requires careful background subtraction and concentration determination

    • Successfully applied to ATP synthase subunits to confirm alpha-helical content

  • Fourier-Transform Infrared (FTIR) Spectroscopy

    • Highly sensitive to secondary structure in membrane environments

    • Can be performed in various sample forms (films, suspensions)

    • Provides orientation information about transmembrane helices

    • Allows measurements in native-like lipid environments

  • Nuclear Magnetic Resonance (NMR) Spectroscopy

    • Solution NMR: suitable for smaller domains or fragments

    • Solid-state NMR: applicable to full-length protein in membranes

    • Provides atomic-level structural and dynamic information

    • Can detect specific interactions with lipids or other subunits

  • Electron Paramagnetic Resonance (EPR) Spectroscopy

    • Site-directed spin labeling combined with EPR

    • Measures distances between labeled sites (DEER/PELDOR)

    • Provides information about conformational dynamics

    • Works well in membrane environments

These methods should be employed in a complementary manner, as each provides different structural information. Researchers should also consider emerging technologies like cryo-electron microscopy for higher-resolution structural characterization of membrane protein complexes.

How might structural variations in Ranunculus macranthus atpI inform the design of more efficient synthetic ATP synthases?

Structural variations in R. macranthus atpI could provide valuable insights for synthetic biology applications:

  • Comparative Structural Analysis

    • Identify unique structural features through detailed sequence and structural comparisons

    • Focus on proton channel residues, subunit interfaces, and regulatory regions

    • Map these variations to functional differences in efficiency, regulation, or environmental adaptation

    • Correlate with chloroplast genome structural variations observed across Ranunculus species

  • Functional Domain Transplantation

    • Design chimeric constructs incorporating R. macranthus-specific domains

    • Test performance metrics under varying conditions (temperature, pH, salt)

    • Identify domains that confer specific advantages for synthetic applications

    • Implement iterative design-build-test cycles for optimization

  • Rational Design Approach

    • Apply molecular dynamics simulations to predict how structural variations affect function

    • Identify key residues for targeted mutagenesis

    • Test hypotheses through site-directed mutagenesis and functional assays

    • Develop computational models to predict performance of novel designs

  • Environmental Adaptation Applications

    • Investigate whether R. macranthus atpI contains adaptations to specific environmental conditions

    • Test performance under stress conditions relevant to biotechnological applications

    • Develop variants optimized for specific industrial or environmental contexts

    • Compare with other Ranunculus species showing evidence of positive selection in ATP synthase components

This research direction connects fundamental structural biology with applied synthetic biology, potentially leading to ATP synthase variants with improved efficiency or novel regulatory properties.

What emerging technologies might revolutionize the study of membrane protein complexes like ATP synthase?

Several emerging technologies show promise for advancing membrane protein research:

  • Cryo-Electron Tomography (Cryo-ET)

    • Allows visualization of membrane proteins in their native cellular context

    • Can reveal structural heterogeneity and interactions with other complexes

    • Sub-tomogram averaging provides higher resolution of specific complexes

    • Could reveal previously unknown associations of ATP synthase in chloroplasts

  • Single-Molecule Techniques

    • FRET-based approaches to monitor conformational dynamics

    • Magnetic tweezers to study rotational mechanics of ATP synthase

    • Single-molecule force spectroscopy to measure protein-protein interactions

    • These techniques can capture rare states and dynamic behaviors missed by ensemble methods

  • Integrative Structural Biology

    • Combining multiple data sources (cryo-EM, NMR, crosslinking-MS, simulations)

    • Computational integration to generate comprehensive structural models

    • Can resolve structures of large complexes with dynamic components

    • Particularly valuable for ATP synthase with its multiple subunits and conformational states

  • Artificial Intelligence Applications

    • Deep learning for improved protein structure prediction

    • Machine learning for experimental design optimization

    • Automated image analysis for cryo-EM and super-resolution microscopy

    • Pattern recognition in complex datasets from multiple experimental approaches

These technologies, when applied to ATP synthase research, could resolve longstanding questions about the coupling mechanism, regulatory interactions, and structural adaptations to different environments.

How might systems biology approaches integrate atpI function into broader photosynthetic metabolism models?

Systems biology offers powerful frameworks for understanding atpI in its broader metabolic context:

These approaches can transform our understanding of how individual components like atpI contribute to the emergent properties of photosynthetic systems, potentially guiding strategies for improving crop productivity or designing artificial photosynthetic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.