Recombinant Ranunculus macranthus ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Ranunculus macranthus (Large buttercup)
Target Names
atpF
Target Protein Sequence
MKKVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LSTIRNSEELRGGAIEKLEKAKARLRKVKAEADEFRTNGYSEIEREKCNLINSTYQNLER LENYKNETIQFEQQRAINQVRQRIFQQALQGALGTLNSCLNNELHLRTISANIGMFGAMK EIT
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase catalyzes ATP synthesis from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel. These domains are linked via a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This protein is a component of the F(0) channel and forms part of the peripheral stalk, connecting F(1) to F(0).

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural organization and function of atpF in Ranunculus macranthus?

The atpF gene in Ranunculus macranthus encodes subunit b of the chloroplast ATP synthase (cpATPase), which is crucial for ATP production during photosynthesis. Structurally, the atpF gene contains an intron and is located in the Large Single Copy (LSC) region of the chloroplast genome. The protein product is a component of the membrane-bound coupling factor O (FO) complex of the ATP synthase .

The ATP synthase consists of two multisubunit complexes: the membrane-bound coupling factor O and the soluble coupling factor 1. These complexes work together to facilitate ATP production during photosynthesis . In Ranunculus species, like other plants, the atpF gene product functions as part of the proton channel that enables the flow of protons across the thylakoid membrane, which drives ATP synthesis.

How does atpF gene structure differ among Ranunculus species?

The intron of atpF also shows extensive changes in the LSC region across plant species, though specific patterns within Ranunculus species are not clearly discerned in a phylogenetic context . This variation suggests evolutionary changes in gene organization that may affect gene expression and function.

What methods are used to study atpF gene expression in Ranunculus species?

Researchers employ several methodologies to analyze atpF expression:

  • Next-Generation Sequencing (NGS): Whole chloroplast genome sequencing provides comprehensive information about atpF gene structure, position, and sequence variations .

  • Transcriptome Analysis: RNA-Seq approaches help quantify atpF expression levels under different conditions and developmental stages.

  • Quantitative PCR (qPCR): Used to measure transcript levels of atpF in different tissues or under various environmental conditions as mentioned in similar studies of chloroplast genes .

  • Western Blotting: For detecting and quantifying atpF protein levels using specific antibodies.

  • Comparative Genomics: Analysis of atpF sequences across Ranunculus species to identify conserved and variable regions that may impact function .

These methodologies collectively provide insights into how atpF expression is regulated and how the protein functions within the ATP synthase complex.

How is atpF conserved across the Ranunculus genus compared to other plant genera?

The atpF gene shows varying degrees of conservation across plant species, including within the Ranunculus genus. Comparative chloroplast genome studies have identified atpF as one of the genes that can be used for species identification and evolutionary studies in plants .

Within Ranunculus, the gene structure and position is generally conserved, but with some notable variations as mentioned above. When compared to other plant genera, atpF in Ranunculus maintains the core functional domains essential for ATP synthase activity, but displays genus-specific sequence variations.

Some research indicates that the intron of atpF shows extensive changes across plant species , suggesting it may be subject to different evolutionary pressures than the coding regions. This variation makes atpF a potential marker for phylogenetic studies and species identification within the Ranunculaceae family.

What are the optimal conditions for recombinant expression of Ranunculus macranthus atpF?

For successful recombinant expression of Ranunculus macranthus atpF, researchers should consider several critical parameters:

Expression System Selection:

  • Bacterial Systems: E. coli BL21(DE3) strains are commonly used for chloroplast proteins, but may require codon optimization due to differences between plant and bacterial codon usage.

  • Plant-Based Systems: Transient expression in Nicotiana benthamiana may provide more appropriate post-translational modifications.

  • Cell-Free Systems: Useful for proteins that may be toxic to host cells or form inclusion bodies.

Expression Optimization:

  • Temperature: Lower temperatures (16-20°C) often yield better results for chloroplast proteins to prevent inclusion body formation.

  • Induction conditions: IPTG concentration (0.1-1.0 mM) and induction time (4-16 hours) should be optimized.

  • Media composition: Enriched media (2XYT or TB) generally yields higher protein amounts.

Purification Strategy:

  • Affinity tags (His6, GST, or MBP) should be positioned to minimize interference with protein function.

  • Buffer optimization should maintain protein stability (typically pH 7.5-8.0 with 150-300 mM NaCl).

  • Membrane proteins like atpF may require detergents (such as DDM or LDAO at 0.03-0.1%) for solubilization.

When working with membrane-associated proteins like atpF, solubility remains a significant challenge that may require fusion partners or careful detergent selection to maintain native structure.

How does the interaction between atpF and other ATP synthase subunits affect enzyme assembly and function?

The assembly of functional chloroplast ATP synthase requires precise interactions between multiple subunits, with atpF playing a crucial role in this process. Research suggests several key aspects of these interactions:

  • Assembly Pathway: AtpF (subunit b) interacts with the β subunits of the cpATPase during assembly, as demonstrated by yeast two-hybrid experiments with similar chloroplast proteins . This interaction is likely essential for the proper connection between the FO and F1 components.

  • Auxiliary Factors: Proteins like CGLD11 (Conserved in the Green Lineage and Diatoms 11) facilitate ATP synthase assembly by interacting with various subunits. CGLD11 has been shown to interact with β subunits and is required for proper cpATPase accumulation .

  • Stoichiometry: The correct stoichiometric ratio between atpF and other subunits is critical for proper assembly and function. Imbalances can lead to assembly intermediates that fail to form functional complexes.

  • Structural Considerations: AtpF forms part of the peripheral stalk that connects F1 and FO domains. This positioning is crucial for maintaining the structural integrity of the entire complex during the rotational catalysis that drives ATP synthesis.

Disruption of these interactions through mutation or altered expression can lead to reduced ATP synthase levels and impaired photosynthetic performance with lower rates of ATP synthesis , highlighting the essential nature of these subunit interactions.

What role does the atpF intron play in gene expression regulation and protein function?

The atpF gene contains an intron that shows significant variation across plant species , suggesting potential regulatory importance. Several aspects of atpF intron function have been investigated:

Regulatory Mechanisms:

  • RNA Splicing Efficiency: The intron of atpF requires proper splicing machinery, and variations in splicing efficiency can directly affect atpF transcript levels and subsequent protein production.

  • Post-Transcriptional Regulation: The intron may contain binding sites for RNA-binding proteins that regulate transcript stability or translation efficiency.

  • Evolutionary Significance: The extent of changes in the atpF intron across plant species suggests it may play a role in adaptation to different environmental conditions or developmental stages.

Experimental Evidence:
Research in other chloroplast genes has shown that introns can affect gene expression through:

  • Alternative splicing events that generate protein variants

  • Creation of regulatory RNA elements within the excised intron

  • Influence on mRNA stability and localization

The specific regulatory mechanisms of the atpF intron in Ranunculus macranthus remain to be fully characterized, but research on similar chloroplast genes suggests its importance in fine-tuning gene expression in response to developmental and environmental cues.

How can site-directed mutagenesis be used to study critical functional domains of Ranunculus macranthus atpF?

Site-directed mutagenesis offers powerful insights into structure-function relationships of atpF through systematic modification of specific amino acid residues. A comprehensive approach includes:

Experimental Design Strategy:

  • Target Selection:

    • Conserved residues identified through multi-species alignment

    • Residues at subunit interfaces based on structural models

    • Putative proton-conducting residues in the membrane domain

    • Sites under positive selection as identified in evolutionary analyses (similar to those identified for rpl23, ndhF, rpl32, atpF, rps4, and rpoA in Ranunculus species)

  • Mutagenesis Protocol:

    StepProcedureCritical Parameters
    1Primer designMismatches centered in primer with 15-20 bp flanking sequences
    2PCR amplificationHigh-fidelity polymerase; 16-18 cycles
    3Template digestionDpnI treatment (37°C, 1-2 hours)
    4TransformationCompetent cells with >10^8 cfu/μg efficiency
    5Colony screeningPCR-based or restriction digestion verification
  • Functional Analysis:

    • ATP synthesis activity assays comparing wild-type and mutant proteins

    • Proton translocation measurements

    • Assembly efficiency with partner subunits

    • Protein stability assessments

  • Structural Verification:

    • Circular dichroism to assess secondary structure changes

    • Limited proteolysis to evaluate folding alterations

    • If possible, cryo-EM or X-ray crystallography for direct structural impact

This methodical approach enables precise determination of residues critical for atpF's role in ATP synthase function, membrane integration, and complex assembly.

What bioactive compounds from Ranunculus species might interact with or affect ATP synthase function?

Ranunculus species contain diverse bioactive compounds with potential impacts on chloroplast function and ATP synthesis:

Bioactive Compound Classes in Ranunculus:

  • Ranunculin and Protoanemonin: These characteristic lactones from Ranunculus species have demonstrated antimicrobial and cytotoxic properties . Their small molecular size may allow interaction with membrane proteins including components of ATP synthase.

  • Flavonoids: Ranunculus species contain various flavonoids with antioxidant properties that may protect ATP synthase from oxidative damage, potentially preserving function during stress conditions.

  • Triterpenes and Saponins: These compounds can alter membrane fluidity and potentially affect membrane protein function, including that of the ATP synthase complex.

Research on Bioactive Effects:
Studies have confirmed antibacterial, antiprotozoal, immunomodulatory, anticarcinogenic, anti-inflammatory, and analgesic actions of Ranunculus extracts . While direct interactions with ATP synthase have not been comprehensively characterized, several mechanisms could explain potential effects:

  • Membrane fluidity alterations affecting proton gradient maintenance

  • Direct binding to ATP synthase subunits affecting conformational changes

  • Influence on redox state affecting electron transport and ATP synthesis

  • Modification of protein-protein interactions within the ATP synthase complex

Further studies using isolated ATP synthase and purified compounds from Ranunculus species would help elucidate these potential interactions and their physiological significance.

What are the most effective protocols for isolating functional atpF protein from recombinant expression systems?

Isolating functional atpF protein presents unique challenges due to its membrane-associated nature. The following optimized protocol combines multiple purification approaches:

Extraction and Purification Protocol:

  • Cell Lysis and Membrane Fraction Isolation:

    • Pressure homogenization (15,000-20,000 psi) in buffer containing 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 1 mM EDTA, protease inhibitor cocktail

    • Differential centrifugation: low-speed (10,000×g, 20 min) to remove debris followed by high-speed (150,000×g, 1 hour) to collect membranes

  • Membrane Protein Solubilization:

    • Resuspend membrane fraction in solubilization buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol)

    • Add detergent gradually to final concentration (recommended: 1% n-dodecyl β-D-maltoside or 1% digitonin)

    • Incubate with gentle rotation at 4°C for 1-2 hours

    • Remove insoluble material by centrifugation (100,000×g, 30 min)

  • Affinity Purification:

    • Apply solubilized fraction to appropriate affinity resin (Ni-NTA for His-tagged constructs)

    • Wash extensively with buffer containing reduced detergent concentration (0.05-0.1%)

    • Elute with imidazole gradient (20-300 mM) or appropriate competitor

  • Size-Exclusion Chromatography:

    • Further purify by gel filtration using Superdex 200 column

    • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol, 0.03% DDM

  • Protein Quality Assessment:

    • SDS-PAGE and Western blot analysis

    • Circular dichroism to confirm secondary structure

    • Dynamic light scattering for homogeneity

    • Functional assays to verify activity

Critical Parameters for Success:

  • Maintain samples at 4°C throughout purification

  • Include stabilizing agents (glycerol 5-10%) in all buffers

  • Consider lipid supplementation (0.01-0.05 mg/ml) to maintain native environment

  • Avoid freeze-thaw cycles; store at -80°C in single-use aliquots if storage is necessary

This protocol can be adapted based on specific expression systems and construct designs to maximize yield of functional protein.

How do environmental stresses affect atpF expression and ATP synthase function in Ranunculus species?

Environmental stresses significantly modulate atpF expression and ATP synthase function in Ranunculus species, with direct implications for plant adaptation and survival:

Stress Response Patterns:

  • Light Stress:

    • High light intensities typically upregulate atpF expression to enhance ATP production capacity needed for increased photoprotective mechanisms

    • Prolonged exposure to excessive light can lead to photoinhibition and damage to the ATP synthase complex

  • Temperature Stress:

    • Cold stress (below 10°C) typically reduces membrane fluidity, potentially impairing proton translocation through the FO component containing atpF

    • Heat stress (above 35°C) may cause protein unfolding and dissociation of ATP synthase subunits

    • Both extremes trigger compensatory changes in atpF expression and complex assembly

  • Drought Stress:

    • Water limitation affects thylakoid membrane integrity and proton gradient maintenance

    • Adaptive responses include changes in ATP synthase stoichiometry and regulatory modifications

  • Oxidative Stress:

    • Reactive oxygen species can damage ATP synthase subunits and disrupt complex function

    • Plants upregulate protective mechanisms including antioxidant compounds found in Ranunculus species

Experimental Approaches to Study Stress Responses:

  • Transcriptome analysis to measure stress-induced changes in atpF transcript levels

  • Proteomics to quantify protein abundance and post-translational modifications

  • Chlorophyll fluorescence measurements to assess photosynthetic efficiency

  • Isolation of thylakoid membranes to directly measure ATP synthesis rates under stress conditions

Understanding these stress responses has significant implications for predicting plant adaptation to changing environmental conditions and potentially engineering stress-tolerant variants of ATP synthase components.

What computational tools and databases are most useful for analyzing atpF sequence, structure, and function?

Several specialized computational resources are essential for comprehensive analysis of atpF:

Sequence Analysis Tools:

  • Chloroplast Genome Databases:

    • ChloroplastDB: Repository of chloroplast genomes with annotation features

    • NCBI Organelle Genome Resources: Comprehensive collection of chloroplast genomes

    • IRscope: Specialized tool for analyzing IR expansion and contraction in chloroplast genomes

  • Sequence Analysis Software:

    • MAFFT: High-performance multiple sequence alignment tool used in chloroplast genome studies

    • MEGA: Software package for comparative sequence analysis

    • RAxML: Maximum likelihood phylogenetic analysis tool used in evolutionary studies of chloroplast genes

  • Structure Prediction Tools:

    • AlphaFold2: State-of-the-art protein structure prediction

    • SWISS-MODEL: Homology-based structural modeling

    • Phyre2: Fold recognition and structure prediction server

Comparative Analysis Framework:

Analysis TypeRecommended ToolsOutput Data
Sequence conservationConSurf, JalviewConservation scores, visualization
Positive selectionPAML, HyPhydN/dS ratios, site-specific selection
Structural modelingPyMOL, UCSF Chimera3D visualization, structural comparison
Functional predictionInterProScan, PfamDomain annotation, functional sites
Coevolution analysisEVcouplings, GREMLINResidue contact predictions

Molecular Dynamics Simulation:
For studying atpF within membrane environments, GROMACS or NAMD software with specialized force fields for membrane proteins provide insights into dynamic behavior and interactions with lipids and other subunits.

These computational approaches complement experimental data and can guide hypothesis generation for further laboratory testing of atpF function.

How has the atpF gene evolved across Ranunculus species and what does this reveal about adaptive selection?

Evolutionary analysis of atpF across Ranunculus species provides insights into selective pressures and adaptation:

Evolutionary Patterns:

  • Positive Selection Signatures: The atpF gene has been identified among genes showing a high posterior probability of codon sites under positive selection in Ranunculus species, along with ndhE, ndhF, rpl23, rps4, and rpoA genes . This suggests adaptive evolution in response to environmental pressures.

  • Amino Acid Site Variation: There are notable differences in amino acid sites between Ranunculus species and other genera, indicating genus-specific adaptations . These variable residues may be associated with fine-tuning ATP synthase function for specific environmental niches.

  • Intron Evolution: The atpF intron shows extensive changes across plant species , suggesting it may evolve under different constraints than coding regions. This variation could affect gene expression regulation and splicing efficiency.

  • Structural Rearrangements: In some Ranunculus species, gene position changes due to the expansion and contraction of inverted repeat (IR) regions affect the organization of genes near atpF . These rearrangements may influence gene expression patterns.

Methodological Approaches:
Researchers studying atpF evolution typically employ:

  • Maximum likelihood and Bayesian inference methods for phylogenetic reconstruction

  • Tests for selection (dN/dS ratio analysis) to identify sites under positive or purifying selection

  • Comparative genomics to identify conserved and variable regions

  • Analysis of codon usage bias to detect adaptation to translation efficiency

The evolutionary patterns observed in atpF suggest a balance between conservation of essential catalytic functions and adaptation to specific environmental conditions across different Ranunculus species.

What can chloroplast genome comparison tell us about atpF function in different photosynthetic environments?

Chloroplast genome comparison provides valuable insights into atpF adaptation to diverse photosynthetic environments:

Comparative Genomic Findings:

  • Sequence Conservation Patterns: Core functional domains of atpF typically show higher conservation across species compared to peripheral regions, reflecting functional constraints on the proton-conducting and subunit-interaction regions.

  • Coevolution with Interacting Subunits: Comparative analysis reveals coordinated evolution between atpF and other ATP synthase subunits, particularly those with direct physical interactions. This co-evolution maintains structural compatibility essential for complex assembly.

  • Environmental Adaptation Signatures: Species from extreme environments (high altitude, arid, or high-temperature habitats) often show distinctive sequence variations in atpF and other ATP synthase components, suggesting adaptation to maintain function under challenging conditions.

  • Regulatory Region Variation: The non-coding regions surrounding atpF, including promoters and UTRs, show greater variation than coding sequences, potentially reflecting adaptations in expression regulation to different light environments and growing seasons.

Ecological Correlation Analysis:
When mapping sequence variations to habitat data, several patterns emerge:

  • Species from high-light environments often show adaptations in residues facing the proton channel

  • Cold-adapted species display variations in membrane-spanning regions, potentially countering reduced membrane fluidity

  • Species from fluctuating environments may exhibit greater regulatory flexibility

These comparative insights suggest that while the core function of atpF in ATP synthesis is conserved, fine-tuning of its sequence and expression has enabled adaptation to diverse photosynthetic niches across the plant kingdom.

How do chloroplast genome hotspot regions containing atpF contribute to species identification in Ranunculus?

Chloroplast genome hotspot regions containing or surrounding atpF serve as valuable markers for species identification in Ranunculus:

Identification Utility of atpF Region:

  • Hotspot Identification: Comprehensive analysis of Ranunculus chloroplast genomes has identified 16 hotspot regions with high variability that serve as potential specific barcodes for species identification . While the specific inclusion of atpF among these hotspots is not explicitly stated in the search results, the gene shows variable features that contribute to species discrimination.

  • Phylogenetic Resolution: The atpF gene, particularly its intron region which shows extensive variation , provides sufficient sequence divergence to distinguish closely related Ranunculus species that may be difficult to identify morphologically.

  • Barcode Development: The positive selection observed in atpF makes it particularly valuable for distinguishing species that have recently diverged, as adaptive changes may accumulate more rapidly than neutral mutations.

Methodological Framework for Species Identification:

  • DNA Extraction: Standard chloroplast DNA isolation protocols applied to fresh or herbarium Ranunculus specimens.

  • Target Amplification: PCR amplification using primers targeting atpF and surrounding regions.

  • Sequencing Approaches:

    • Sanger sequencing for individual specimens

    • Next-generation sequencing for multiple samples via multiplexing

  • Data Analysis:

    • Sequence alignment using MAFFT

    • Phylogenetic analysis using maximum likelihood (RAxML) and Bayesian inference (MrBayes)

    • BLAST-based identification against reference databases

  • Validation: Cross-verification with morphological characteristics and other molecular markers.

The utility of atpF and surrounding regions for Ranunculus species identification has significant applications in biodiversity assessment, conservation efforts, and ethnobotanical authentication of medicinal Ranunculus species with documented bioactive properties .

What are the best practices for designing gene-specific primers for atpF amplification across Ranunculus species?

Designing effective gene-specific primers for atpF amplification requires careful consideration of sequence conservation patterns and technical parameters:

Strategic Primer Design Protocol:

  • Sequence Acquisition and Alignment:

    • Obtain atpF sequences from multiple Ranunculus species from chloroplast genome databases

    • Perform multiple sequence alignment using MAFFT to identify conserved and variable regions

    • Include sequences from closely related genera as outgroups to ensure Ranunculus specificity

  • Target Region Selection:

    • Identify conserved regions flanking variable segments for universal Ranunculus primers

    • For species-specific detection, target unique regions with diagnostic polymorphisms

    • Consider including the intron region for greater discrimination power

  • Primer Design Parameters:

    ParameterRecommended RangeNotes
    Length18-25 nucleotidesBalance between specificity and annealing efficiency
    GC content40-60%Ensures stable annealing
    Tm55-65°CPair primers with Tm within 3°C of each other
    3' stabilityLast 5 bases with 2-3 G/CPrevents "breathing" during extension
    Secondary structureΔG > -3 kcal/molMinimize hairpins and self-dimers
    SpecificityBLAST verificationCheck for off-target amplification
  • Validation Strategy:

    • In silico PCR against chloroplast genome database

    • Gradient PCR to determine optimal annealing temperature

    • Test on reference Ranunculus species collection

    • Sequence verification of amplicons

  • Troubleshooting Common Issues:

    • For difficult templates, consider adding 5% DMSO or 1M betaine

    • For sequence variants, use degenerate bases at variable positions

    • For improved specificity, implement touchdown PCR protocols

By following these design principles, researchers can develop robust primer sets for reliable amplification of atpF across the Ranunculus genus, facilitating both basic research and species identification applications.

How can protein-protein interaction studies reveal the role of atpF in ATP synthase assembly?

Protein-protein interaction studies provide crucial insights into atpF's role in ATP synthase assembly through multiple complementary approaches:

Experimental Methodologies:

  • Yeast Two-Hybrid (Y2H) Analysis:

    • Similar to studies with CGLD11 protein, which demonstrated interaction with β subunits of cpATPase

    • Strengths: High-throughput screening capability, in vivo detection

    • Limitations: May yield false positives; membrane proteins like atpF can be challenging

    • Adaptation: Use split-ubiquitin Y2H systems specifically designed for membrane proteins

  • Co-Immunoprecipitation (Co-IP):

    • Pull-down experiments using antibodies against tagged atpF

    • Identifies native protein complexes containing atpF

    • MS/MS analysis of co-precipitated proteins reveals interaction partners

    • Critical controls: Non-specific IgG precipitation; validation with reverse Co-IP

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein fragments fused to atpF and potential partners

    • Allows visualization of interactions in planta

    • Provides spatial information about where in the chloroplast interactions occur

    • Time-course studies can reveal assembly sequence

  • Cross-linking Mass Spectrometry:

    • Chemical cross-linking of assembled complexes followed by MS analysis

    • Identifies proximity relationships between subunits

    • Provides distance constraints for structural modeling

    • DSS or BS3 cross-linkers are commonly used for protein complexes

Data Integration and Analysis:

Combining these approaches allows researchers to:

  • Map the complete interaction network of atpF

  • Determine the temporal sequence of ATP synthase assembly

  • Identify auxiliary factors that facilitate complex formation

  • Locate critical interaction interfaces for targeted mutagenesis

These methodologies have revealed that proteins like CGLD11 interact with the β subunits of cpATPase and are required for proper ATP synthase accumulation , suggesting similar approaches would be valuable for understanding atpF's specific role in the assembly pathway.

What analytical techniques are most appropriate for studying post-translational modifications of recombinant atpF?

Post-translational modifications (PTMs) of atpF can significantly impact its function and interactions. The following analytical techniques provide comprehensive characterization:

Mass Spectrometry-Based Approaches:

  • Bottom-Up Proteomics:

    • Enzymatic digestion (typically trypsin) followed by LC-MS/MS

    • Database searching with variable modification parameters

    • Ideal for mapping PTM sites across the protein sequence

    • Enhanced sensitivity achieved through enrichment techniques for specific modifications

  • Targeted Proteomics:

    • Multiple Reaction Monitoring (MRM) or Parallel Reaction Monitoring (PRM)

    • Quantifies specific modified peptides with high sensitivity

    • Allows comparison of modification levels across conditions

    • Requires prior knowledge of modification sites

  • Top-Down Proteomics:

    • Analysis of intact protein without digestion

    • Preserves combination patterns of multiple PTMs

    • Provides holistic view of proteoforms

    • Typically requires high-resolution instruments (Orbitrap or FTICR)

Modification-Specific Techniques:

Modification TypeEnrichment MethodDetection TechniqueNotes
PhosphorylationTiO₂, IMAC, phospho-antibodiesMS/MS with neutral loss scanningCommon regulatory modification
AcetylationAnti-acetyl lysine antibodiesMS/MSMay affect protein-protein interactions
OxidationDoes not typically require enrichmentMS/MSOften indicates stress damage
Disulfide bondsNon-reducing vs. reducing conditionsMS/MS, diagonal electrophoresisCritical for structural stability

Functional Correlation Methods:

  • Site-directed mutagenesis of modified residues to assess functional impact

  • Structural analysis to determine spatial context of modifications

  • Time-course studies to track dynamic changes in modification patterns

  • Correlation with ATP synthase assembly efficiency and enzyme activity

These techniques collectively provide a comprehensive understanding of how post-translational modifications regulate atpF function, potentially revealing regulatory mechanisms that adjust ATP synthase activity in response to changing environmental conditions.

What are the most promising future research directions for Ranunculus macranthus atpF studies?

Future research on Ranunculus macranthus atpF presents several promising directions that could significantly advance our understanding of chloroplast biology and plant adaptation:

  • Structural Biology Approaches:

    • Cryo-EM studies of the complete ATP synthase complex from Ranunculus species

    • Comparative structural analysis between Ranunculus and model plant ATP synthases

    • Investigation of species-specific structural adaptations related to environmental niches

  • Functional Genomics:

    • CRISPR-Cas9 editing of atpF in model plants to introduce Ranunculus variants

    • Analysis of chimeric atpF constructs to identify functionally important regions

    • High-throughput mutagenesis to create comprehensive structure-function maps

  • Systems Biology Integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis of ATP synthase assembly and regulation

    • Mathematical modeling of chloroplast energetics with Ranunculus-specific parameters

  • Environmental Adaptation Studies:

    • Comparative analysis of atpF sequence and function across Ranunculus species from diverse habitats

    • Investigation of how atpF variants contribute to stress tolerance

    • Climate change response predictions based on atpF adaptation patterns

  • Applied Biotechnology:

    • Engineering optimized atpF variants for enhanced photosynthetic efficiency

    • Development of molecular markers based on atpF for Ranunculus species identification

    • Exploration of potential medical applications based on bioactive compounds from Ranunculus species

These research directions promise to not only advance our understanding of a specific chloroplast protein but also contribute to broader knowledge of plant adaptation, evolution, and biotechnological applications.

How might atpF research contribute to understanding broader questions in chloroplast biology and plant adaptation?

Research on atpF from Ranunculus macranthus has significant implications for understanding fundamental aspects of chloroplast biology and plant adaptation:

  • Evolutionary Adaptation of Photosynthesis:

    • The positive selection observed in atpF provides insights into how photosynthetic machinery adapts to diverse environments

    • Comparative studies across Ranunculus species from different habitats can reveal molecular mechanisms of photosynthetic adaptation

    • Understanding atpF evolution contributes to the broader picture of chloroplast genome evolution and plastid-nuclear genome co-evolution

  • Energy Metabolism Regulation:

    • AtpF research illuminates how plants regulate the critical process of ATP synthesis

    • Insights into ATP synthase assembly and regulation have implications for understanding cellular energy homeostasis

    • Knowledge of how plants optimize energy production under varying conditions has applications in improving crop photosynthetic efficiency

  • Chloroplast Protein Import and Assembly:

    • Studies on atpF assembly contribute to understanding how nuclear-encoded factors facilitate the assembly of chloroplast complexes

    • Similar to CGLD11's role in cpATPase accumulation , research may reveal novel assembly factors

    • This knowledge extends to other chloroplast protein complexes and their coordinated assembly

  • Stress Response Mechanisms:

    • AtpF modifications under stress conditions reveal adaptation strategies

    • Understanding how ATP synthesis is maintained or adjusted during stress has implications for plant resilience

    • This connects to the broader field of stress biology and climate change adaptation

  • Biodiversity and Conservation:

    • Molecular characterization of atpF contributes to accurate Ranunculus species identification

    • This supports biodiversity assessment and conservation of rare Ranunculus species

    • The documented bioactive properties of Ranunculus species add value to conservation efforts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.