Recombinant Ranunculus macranthus Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Characterization of Recombinant Oenothera argillicola cemA

The recombinant cemA protein from Oenothera argillicola has been extensively characterized, providing a template for understanding potential features of Ranunculus macranthus cemA. Key details include:

Core Functions of Chloroplast Envelope Proteins

  1. Transport Activities:

    • Ion and metabolite transport (e.g., phosphate transporters) .

    • Lipid metabolism (e.g., tocopherol synthesis) .

  2. Protein Import Machinery:

    • Components of the TIC-TOC complexes for protein translocation .

  3. Membrane Stability:

    • Proteins with multiple transmembrane domains (e.g., 4+ α-helical TM regions) .

Table 2: Key Features of Chloroplast Envelope Transporters

FeatureDescription
pI>8.8 (basic isoelectric point)
Transmembrane Domains≥4 α-helical TM regions
Res/TM Ratio<100 (high hydrophobicity)

Phylogenetic Context of Ranunculus macranthus

Ranunculus macranthus has been used as an outgroup in chloroplast genome studies, particularly in comparisons involving mangrove species (Ceriops and Avicennia) and other Ranunculaceae . While these studies focus on genome structure and SSR markers, they underscore the utility of Ranunculus species in evolutionary analyses.

Research Gaps and Recommendations

  1. Species-Specific Data:

    • No direct evidence exists for Ranunculus macranthus cemA in the provided sources.

    • Cross-referencing with Oenothera cemA may inform hypotheses about Ranunculus homologs.

  2. Methodological Approaches:

    • Proteomic Strategies: Use chloroform/methanol extraction and SDS-PAGE to isolate hydrophobic envelope proteins .

    • Bioinformatics: Screen for proteins with chloroplast transit peptides (ChloroP), basic pI, and TM domains .

  3. Functional Validation:

    • Confirm subcellular localization via fluorescence tagging or immunogold labeling .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses and avoid repeated freeze-thaw cycles to preserve protein integrity.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate your preference, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Ranunculus macranthus (Large buttercup)
Target Names
cemA
Target Protein Sequence
MQKKKAFNPLLYLTSIVFLSWSISFSFKKSMESLVIHWWNAEQSEVFLNDIQEKSALEKF IELEELLFLDEMIKESPDIHIQKLRIGIHKETIQLVKMYNEGHIHTILNFLTNIISFAIL SVFYILGNEQLVILNSWVREFIYNLSDTIKAFCILLLTDLCIGFHSPHGWELMIGSVYKD FGFSHNNQIISGLVSTFPVILDTIFKYLIFRYLNRVSPSLVVIYHSIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and what is its function in the chloroplast?

The chloroplast envelope membrane protein A (cemA) is a protein encoded by the chloroplast genome that localizes to the inner envelope membrane of chloroplasts. It functions primarily in CO2 uptake across the chloroplast membrane, facilitating carbon fixation during photosynthesis. Studies of chloroplast envelope membranes have revealed that cemA belongs to a class of proteins involved in ion and metabolite transport across these limiting membranes . The protein plays a crucial role in maintaining the biochemical machinery necessary for proper chloroplast development and integration of chloroplast function within plant cells.

How is the cemA gene organized in the Ranunculus macranthus chloroplast genome?

The cemA gene in Ranunculus macranthus is located in the large single copy (LSC) region of the chloroplast genome. Comparative genomic analyses have shown that the Ranunculus macranthus chloroplast genome exhibits several structural rearrangements compared to other members of the Ranunculaceae family . Specifically, Ranunculus macranthus shares three inversions in the LSC region with related genera such as Anemone, Hepatica, and Pulsatilla, which affects the organization of genes including cemA . These genomic rearrangements provide important evolutionary context for understanding cemA gene structure and expression in Ranunculus macranthus.

What methodologies are most effective for identifying cemA post-translational modifications?

To identify post-translational modifications (PTMs) of cemA:

  • Mass Spectrometry Analysis: Liquid chromatography tandem mass spectrometry (LC-MS/MS) is the gold standard for PTM identification. Research on chloroplast envelope proteins has shown that some proteins, including potential transport proteins like cemA, undergo N-alpha acetylation . This approach can determine the accurate location of the N-terminus of the mature protein.

  • Phosphoproteomic Analysis: Enrich for phosphopeptides using titanium dioxide (TiO2) or immobilized metal affinity chromatography (IMAC) before MS analysis.

  • Site-Directed Mutagenesis: Convert potential modification sites to non-modifiable residues to assess functional changes.

  • Western Blotting: Use PTM-specific antibodies for validation of identified modifications.

Common PTMs in Chloroplast ProteinsDetection MethodFunctional Significance
N-alpha acetylationLC-MS/MSProtein stability, localization
PhosphorylationPhosphoproteomics, 32P labelingRegulation of activity
Redox modificationsRedox proteomicsResponse to oxidative stress
GlycosylationGlycoproteomicsProtein folding, stability

What expression systems are optimal for recombinant Ranunculus macranthus cemA production?

The selection of an expression system for recombinant cemA production requires careful consideration of the protein's membrane-associated nature. Based on studies of chloroplast envelope proteins:

Bacterial Expression Systems:

  • E. coli: While commonly used, membrane proteins like cemA often form inclusion bodies. Using specialized strains (C41/C43) with fusion tags (MBP, SUMO) can improve solubility.

  • Lactococcus lactis: This system has been successful for expressing membrane proteins with maintained functionality.

Eukaryotic Expression Systems:

  • Insect cells: The baculovirus expression system provides a eukaryotic environment that may better support proper folding of complex membrane proteins.

  • Plant-based systems: Transient expression in Nicotiana benthamiana allows for expression in a native-like environment.

For cemA specifically, a combination of strategies may be necessary, similar to those employed for extracting envelope proteins from chloroplasts, which have included chloroform/methanol extraction and alkaline or saline treatments to retrieve proteins with varying hydrophobicity .

How can I optimize purification protocols for recombinant cemA while maintaining native structure?

Purification of membrane proteins like cemA presents unique challenges. Based on research with chloroplast envelope membrane proteins:

  • Membrane Extraction: Use mild detergents like DDM, LMNG, or digitonin that preserve protein-lipid interactions. Initial extraction should be optimized with a detergent screen.

  • Affinity Purification: Incorporate an N- or C-terminal affinity tag (His6, FLAG, or Strep-tag II) positioned to avoid disrupting membrane domains. For cemA, N-terminal tags may be preferable based on knowledge of chloroplast protein topology.

  • Size Exclusion Chromatography: Essential for removing aggregates and ensuring homogeneity of the purified protein.

  • Lipid Supplementation: Addition of chloroplast lipids (MGDG, DGDG) during purification may help maintain native structure and function.

  • Stability Assessment: Monitor protein stability using techniques like thermal shift assays and circular dichroism to ensure the native structure is preserved.

Several chloroplast envelope membrane proteins have been successfully purified using these approaches, demonstrating the feasibility of obtaining structurally intact recombinant cemA .

How can recombinant cemA be utilized to study CO2 transport mechanisms in chloroplasts?

Recombinant cemA can serve as a valuable tool for investigating CO2 transport through several experimental approaches:

  • Liposome Reconstitution Assays: Purified recombinant cemA can be incorporated into liposomes containing pH-sensitive fluorescent dyes to measure CO2/bicarbonate transport rates under various conditions.

  • Isotope Flux Studies: Using 14C-labeled bicarbonate to measure transport across cemA-containing membranes provides quantitative data on transport kinetics.

  • Electrophysiology: Planar lipid bilayer or patch-clamp techniques can assess cemA-mediated ion movements associated with CO2 transport.

  • Structure-Function Analysis: Site-directed mutagenesis of conserved residues identified through comparative analysis of Ranunculus macranthus cemA with other species can identify critical domains for CO2 transport function.

  • Interaction Studies: Co-immunoprecipitation or crosslinking experiments with recombinant cemA can identify protein partners involved in the CO2 uptake machinery.

These methodologies provide complementary information about cemA's role in carbon concentration mechanisms, which is essential for understanding how plants like Ranunculus macranthus optimize photosynthetic efficiency.

What techniques are most effective for studying protein-protein interactions involving cemA?

To investigate cemA's interaction network:

  • Co-immunoprecipitation (Co-IP): Using antibodies against recombinant cemA to pull down interaction partners from chloroplast extracts.

  • Bimolecular Fluorescence Complementation (BiFC): Split fluorescent proteins fused to cemA and potential partners can visualize interactions in vivo.

  • Proximity-based Labeling: Techniques like BioID or APEX2 fused to cemA can identify nearby proteins in the native chloroplast environment.

  • Crosslinking Mass Spectrometry (XL-MS): Chemical crosslinking coupled with MS analysis can map interaction interfaces at the amino acid level.

  • Surface Plasmon Resonance (SPR): Quantitative measurement of binding kinetics between purified cemA and partner proteins.

Interaction Analysis TechniqueAdvantagesLimitationsApplication to cemA
Co-IP/Pull-downIdentifies native complexesMay miss transient interactionsCan detect stable cemA complexes
BiFCVisualizes interactions in vivoPotential false positives due to protein overexpressionCan confirm suspected interactions
Crosslinking MSMaps interaction interfacesComplex data analysisIdentifies specific binding domains
Proximity LabelingDetects weak/transient interactionsPotential false positivesMaps cemA's microenvironment
SPR/BLIQuantitative binding parametersRequires purified proteinsMeasures affinity for putative partners

How do comparative genomic analyses of cemA across plant species inform evolutionary understanding?

Comparative genomic analyses of cemA provide valuable evolutionary insights:

The chloroplast genome of Ranunculus macranthus has been fully sequenced and compared with other members of the Ranunculaceae family, revealing significant genomic rearrangements . These studies show that Ranunculus macranthus shares three inversions in the Large Single Copy (LSC) region with related genera, affecting the organization of genes including cemA .

Evolutionary analyses can address:

  • Selection Pressure: Calculate dN/dS ratios across cemA sequences to identify regions under positive or purifying selection.

  • Structural Conservation: Compare predicted protein structures to identify conserved functional domains despite sequence divergence.

  • Co-evolution Analysis: Identify correlated evolutionary patterns between cemA and other chloroplast or nuclear genes that may function together.

  • Horizontal Gene Transfer: Assess whether cemA has been transferred to the nuclear genome in any lineages, which would provide insights into chloroplast genome evolution.

  • Adaptation Signatures: Correlate cemA sequence variations with ecological adaptations, particularly in species like Ranunculus macranthus that may face varying CO2 availability in their habitats.

This evolutionary context is essential for interpreting experimental results and designing targeted functional studies of recombinant cemA.

What computational approaches can predict structure-function relationships in cemA?

Advanced computational methods for cemA structure-function prediction include:

  • Homology Modeling: Using structurally characterized membrane proteins as templates to predict cemA structure.

  • Molecular Dynamics Simulations: Simulate cemA behavior within a lipid bilayer to predict dynamic conformational changes during function.

  • Machine Learning Approaches:

    • Support Vector Machines and Neural Networks can identify functional residues based on sequence conservation patterns

    • Sequence covariation analysis can predict residue contacts within the protein structure

  • Quantum Mechanics/Molecular Mechanics (QM/MM): For detailed modeling of CO2 transport mechanisms through the protein.

  • AlphaFold2/RoseTTAFold: These AI-based tools have revolutionized protein structure prediction and can generate high-confidence models of cemA despite limited experimental structural data.

Implementing these computational approaches alongside experimental validation creates a powerful framework for understanding cemA function at the molecular level.

Why is my recombinant cemA protein aggregating and how can I improve solubility?

Aggregation of recombinant cemA is a common challenge given its membrane protein nature. Solutions include:

  • Optimize Extraction Conditions: Based on approaches used for chloroplast envelope proteins, employ a combination of extraction methods:

    • Try chloroform/methanol extraction for highly hydrophobic regions

    • Test alkaline or saline treatments for less hydrophobic regions

    • Use a systematic detergent screen (DDM, LMNG, CHAPS) at varying concentrations

  • Expression Modifications:

    • Lower expression temperature (16-20°C)

    • Reduce induction strength

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

  • Fusion Partners:

    • Solubility-enhancing tags (MBP, SUMO, Trx)

    • Add flexible linkers between cemA and tags

  • Buffer Optimization:

    • Screen pH ranges (typically 7.0-8.5)

    • Test various salt concentrations (100-500 mM)

    • Include stabilizing additives (glycerol 5-20%, sucrose, arginine)

  • Structural Modifications:

    • Express stable domains separately

    • Identify and remove aggregation-prone regions

    • Introduce stabilizing mutations based on protein design algorithms

Developing a stable, soluble preparation of recombinant cemA may require iterative optimization of these parameters, similar to approaches used for other challenging chloroplast envelope membrane proteins .

What controls should be included in functional assays involving recombinant cemA?

Robust functional assays for recombinant cemA require rigorous controls:

  • Negative Controls:

    • Empty liposomes/membrane systems without cemA

    • Heat-denatured cemA protein to confirm activity loss

    • Non-functional cemA mutants (identified through structure-function analyses)

    • Liposomes with unrelated membrane proteins of similar size/structure

  • Positive Controls:

    • Known CO2 transporters from other systems

    • Native chloroplast envelope membrane preparations

    • Previously validated recombinant cemA (if available)

  • Specificity Controls:

    • Transport assays with non-substrate molecules

    • Competitive inhibition studies

    • pH/ion gradient controls to rule out passive diffusion

  • Technical Controls:

    • Multiple protein preparations to ensure reproducibility

    • Concentration gradients to establish kinetic parameters

    • Time-course measurements to capture transport dynamics

  • System Validation:

    • Verification of cemA incorporation into experimental membranes

    • Confirmation of proper protein orientation

    • Assessment of membrane integrity throughout the assay

These controls help distinguish genuine cemA-mediated transport from artifacts and provide benchmarks for comparing results across different experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.