Recombinant Ranunculus macranthus NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Ranunculus macranthus (Large buttercup)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIISSVIPILAFLISGVLAPINEGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFVEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic and potentially chloroplast respiratory chains. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction with proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NAD(P)H-quinone oxidoreductase in photosynthetic organisms?

NAD(P)H-quinone oxidoreductase serves as a critical component in electron transport chains, particularly in photosynthetic organisms. It catalyzes the reduction of quinones to the less toxic quinol form through a two-electron reduction mechanism. In chloroplasts, this enzyme participates in cyclic electron flow (CEF), which is essential for generating ATP without producing NADPH, helping maintain the appropriate ATP/NADPH ratio required for carbon fixation. The enzyme plays a vital role in photoprotection and adaptation to various environmental stresses by facilitating alternative electron transport pathways. In C4 plants like Setaria viridis, the NDH complex is indispensable for C4 photosynthesis, as impaired cyclic electron flow jeopardizes the ATP supply to the C3 cycle .

How does the structure of NAD(P)H-quinone oxidoreductase relate to its function?

NAD(P)H-quinone oxidoreductase typically exists as a homodimeric enzyme, with each subunit containing binding sites for both NAD(P)H and the quinone substrate. The functional relationship between subunits appears to depend on the type of electron acceptor: with two-electron acceptors (like 2,6-dichloroindophenol and menadione), the subunits function independently, while with four-electron acceptors (like methyl red), they function dependently . This structure-function relationship is evident from studies with heterodimers containing one wild-type and one mutant subunit, where the kinetic parameters for two-electron acceptors showed approximately 50% of the activity of wild-type homodimers, suggesting independent subunit functionality .

The active site architecture, particularly the presence of stabilizing residues like histidine or tyrosine that can interact with FMN after reduction by NAD(P)H, influences the enzyme's redox potential and substrate preferences. For instance, in Pseudomonas aeruginosa azoreductases (which have been shown to function as NAD(P)H quinone oxidoreductases), the presence of His144 or Tyr145 versus Phe150, dramatically affects the stabilization of the reduced FMN and consequently alters substrate specificity .

What expression systems are most effective for producing functional recombinant NAD(P)H-quinone oxidoreductase?

For functional expression of recombinant NAD(P)H-quinone oxidoreductase, E. coli-based expression systems have proven effective as demonstrated in studies with related enzymes. When expressing these proteins, researchers should consider:

  • Vector selection: pET expression vectors under the control of T7 promoters offer high-level expression for NAD(P)H-dependent flavoenzymes.

  • Expression conditions: Optimal expression typically requires induction at OD600 ~0.6-0.8, with IPTG concentrations between 0.1-0.5 mM, and post-induction growth at lower temperatures (16-25°C) to enhance proper folding.

  • Solubility enhancement: Co-expression with chaperones or use of fusion tags (His-tag, MBP, GST) can improve solubility.

  • Cofactor incorporation: Supplementing growth media with riboflavin (5-10 μM) can enhance flavin incorporation during expression.

For purification, immobilized metal affinity chromatography using nickel nitrilotriacetate columns has been successful with His-tagged versions of related enzymes. Stepwise elution with imidazole under non-denaturing conditions provides efficient purification, as demonstrated with wild-type/mutant heterodimers of related NAD(P)H:quinone oxidoreductases .

What are the reliable methods for measuring NAD(P)H-quinone oxidoreductase activity?

Researchers can employ several approaches to measure NAD(P)H-quinone oxidoreductase activity:

Spectrophotometric Assay Method:

  • Prepare reaction mixtures containing 50 μM quinone substrate, 500 μM NAD(P)H, and 0.1-10 μg enzyme in buffer (typically 20 mM Tris-HCl pH 8, 100 mM NaCl) with 5% (v/v) DMSO.

  • Monitor the decrease in absorbance at 340 nm, which corresponds to NAD(P)H oxidation.

  • Determine reaction rates by fitting the change in OD340 over the first five minutes of the reaction.

  • Include controls without enzyme to account for non-enzymatic NAD(P)H oxidation .

Data Analysis and Enzyme Kinetics Parameters:

ParameterCalculation MethodNotes
Initial RateΔOD340/min × dilution factor × extinction coefficient correctionEnsure linearity during measurement period
Specific Activityμmol substrate/min/mg enzymeExpress as U/mg where 1U = 1 μmol/min
Km and VmaxMichaelis-Menten or Lineweaver-Burk plotsMaintain >5:1 molar ratio of NAD(P)H to quinone

For accurate measurements, researchers should be aware that poor aqueous solubility of quinones and limitations on NAD(P)H concentration (to remain within the linear range of detection and maintain appropriate molar ratios) can complicate determination of kinetic parameters .

How can researchers optimize purification protocols for recombinant NAD(P)H-quinone oxidoreductase?

Optimal purification of recombinant NAD(P)H-quinone oxidoreductase requires a strategic approach:

  • Lysis and Initial Extraction:

    • Use buffer containing 20-50 mM Tris or phosphate (pH 7.5-8.0), 100-300 mM NaCl, and 5-10% glycerol.

    • Include protease inhibitors to prevent degradation.

    • Consider adding 0.5-1 mM DTT or β-mercaptoethanol to maintain reducing conditions.

  • Affinity Chromatography:

    • For His-tagged proteins, nickel nitrilotriacetate columns allow efficient purification under non-denaturing conditions.

    • Apply stepwise elution with increasing imidazole concentrations (10-250 mM) .

    • For heterodimeric studies, this approach effectively separates heterodimers from homodimers.

  • Additional Purification Steps:

    • Ion exchange chromatography can remove contaminants with different charge properties.

    • Size exclusion chromatography helps verify and isolate the dimeric form of the enzyme.

  • Storage Considerations:

    • Store in Tris-based buffer with 50% glycerol at -20°C for extended stability.

    • For longer preservation, -80°C storage is recommended.

    • Avoid repeated freeze-thaw cycles; instead, prepare working aliquots for 4°C storage for up to one week .

Using this approach, researchers have successfully purified heterodimeric forms of related enzymes, as confirmed by SDS and non-denaturing polyacrylamide gel electrophoresis and immunoblot analysis .

What substrate specificity profiles distinguish NAD(P)H-quinone oxidoreductase subunits?

NAD(P)H-quinone oxidoreductases from the same organism often exhibit complementary substrate specificity profiles, allowing them to collectively reduce a wide range of quinones. Based on studies with related enzymes:

Substrate Preferences by Quinone Structure:

Quinone TypeExample SubstratesPreferred by
BenzoquinonesBenzoquinone (Bzq), 2,5-dichlorobenzoquinone (Dcb)paAzoR1
NaphthoquinonesMenadione (Men), Plumbagin (Plu), Juglone (Jug)paAzoR3
Complex QuinonesCoenzyme Q1 (UQ1), Adrenochrome (Adr)Varies by enzyme

The structural features of the enzyme's active site significantly influence these preferences. For instance:

  • Active Site Size: Larger active sites (as in paAzoR3) can accommodate bulkier quinones.

  • FMN Environment: The local environment around the FMN cofactor affects the redox potential and thus substrate preferences.

  • Stabilizing Residues: The presence of residues like His144 or Tyr145 that can stabilize the negative charge on FMN after reduction by NAD(P)H influences reactivity .

These differences in substrate specificity among NAD(P)H quinone oxidoreductases from the same organism suggest evolutionary adaptation to provide comprehensive protection against diverse quinones encountered in the cellular environment.

How does the NDH complex contribute to cyclic electron flow in C4 photosynthesis?

The NAD(P)H dehydrogenase (NDH) complex plays a crucial role in cyclic electron flow (CEF) in C4 plants, particularly in bundle sheath cells where it supports the specialized C4 photosynthetic pathway:

  • Energetic Requirements: In NADP-ME type C4 species, bundle sheath cells require ATP for regenerating ribulose 1,5-bisphosphate (the substrate for Rubisco) while receiving NADPH from mesophyll cells through malate and triose phosphate influx. The bundle sheath electron transport chain becomes specialized to primarily generate ATP through active CEF .

  • NDH Contribution: The NDH complex mediates CEF by recycling electrons from ferredoxin back to the plastoquinone pool, enabling continued ATP production without net NADPH formation. This process is critical for maintaining the appropriate ATP/NADPH ratio required for carbon fixation in bundle sheath chloroplasts.

  • Consequences of NDH Deficiency: Studies in Setaria viridis using CRISPR/Cas9-edited ndhO null alleles demonstrate that plants lacking NDH showed severe reduction of aboveground biomass to approximately 30% of wild type. This growth defect could not be rescued by supplementing with 2% CO2, highlighting the essential nature of NDH-mediated CEF in C4 photosynthesis .

These findings indicate that NDH is indispensable for C4 photosynthesis, as impaired CEF jeopardizes the ATP supply to the C3 cycle. Engineering fully operational NADP-ME type C4 photosynthesis into C3 plants would require upregulating NDH abundance in bundle sheath cells to achieve desired increases in assimilation and radiation use efficiency .

What molecular mechanisms determine electron transfer efficiency in NAD(P)H-quinone oxidoreductases?

The electron transfer efficiency in NAD(P)H-quinone oxidoreductases is determined by several molecular mechanisms:

  • Cofactor Interaction: The redox potential of the flavin mononucleotide (FMN) group significantly influences electron transfer rates. In Pseudomonas aeruginosa azoreductases (which function as NAD(P)H quinone oxidoreductases), the negative charge imparted to FMN after reduction by NAD(P)H is stabilized differently across enzyme variants:

    • In paAzoR2, stabilization occurs via interaction with His144

    • In paAzoR3, stabilization occurs via interaction with Tyr145

    • In paAzoR1, no such stabilization exists as the equivalent residue is Phe150

  • Subunit Cooperation: Subunit interactions differ based on the electron acceptor:

    • With two-electron acceptors (like 2,6-dichloroindophenol and menadione), subunits function independently

    • With four-electron acceptors (like methyl red), subunits function dependently

  • Active Site Architecture: The size and chemistry of the active site dictate which substrates can be accommodated and properly oriented for electron transfer. Larger active sites can accommodate bulkier quinones, explaining why some enzymes prefer benzoquinones while others prefer naphthoquinones .

Understanding these molecular determinants of electron transfer efficiency could guide protein engineering efforts to enhance the catalytic properties of NAD(P)H-quinone oxidoreductases for specific applications in both research and biotechnology.

How can CRISPR/Cas9 gene editing be applied to study NAD(P)H-quinone oxidoreductase function in vivo?

CRISPR/Cas9 gene editing offers powerful approaches for studying NAD(P)H-quinone oxidoreductase function in vivo:

Methodology for Creating Null Alleles:

  • Target Selection: Design gRNAs targeting exonic regions with the pattern 'A..19N..NGG' where NGG is the protospacer adjacent motif. The use of 'A' as the first base maximizes expression from RNA polymerase III promoters like the Oryza sativa snoRNA U3 (OsU3) promoter .

  • Construct Assembly: Create gene constructs containing:

    • Selection marker (e.g., hygromycin phosphotransferase gene driven by OsAct1 promoter)

    • Cas9 under control of a constitutive promoter (e.g., ZmUbi1)

    • gRNAs forming a polycistronic gene for processing via the endogenous tRNA-processing system

  • Transformation and Selection: Transform plants using Agrobacterium-mediated methods and select transformants on hygromycin. Analyze for transgene copy number using digital PCR .

  • Mutation Verification: Confirm mutations through sequencing and verify protein absence using immunoblotting with antibodies against the target protein or complex subunits .

Research Applications:

This approach has been successfully used to create ndhO null alleles in Setaria viridis, resulting in frameshift mutations that prevented NDH complex assembly. These mutants exhibited severe biomass reduction (30% of wild type), demonstrating the essential nature of NDH-mediated cyclic electron flow in C4 photosynthesis .

Similar approaches could be applied to study various subunits of the NAD(P)H-quinone oxidoreductase complex in Ranunculus macranthus and other plant species, enabling researchers to elucidate the specific functions of individual subunits in different photosynthetic contexts.

How can researchers differentiate between the activities of different NAD(P)H-quinone oxidoreductase subunits?

Differentiating between activities of different NAD(P)H-quinone oxidoreductase subunits requires strategic experimental approaches:

Substrate Specificity Profiling:

  • Test a diverse panel of quinones including:

    • Benzoquinones: Benzoquinone (Bzq), 2,5-dichlorobenzoquinone (Dcb), 2,3,5,6-tetrachloro-1,4-benzoquinone (Tcq)

    • Naphthoquinones: Menadione (Men), Plumbagin (Plu), Juglone (Jug), Lawsone (Law), 1,2-naphthoquinone (Onq)

    • Other quinones: Coenzyme Q1 (UQ1), Phenol blue (Phb), Adrenochrome (Adr)

  • Analyze relative activity patterns. Different subunits exhibit characteristic substrate preference patterns:

SubunitHigh Activity SubstratesLow Activity Substrates
paAzoR1-likeBenzoquinonesComplex quinones
paAzoR3-likeNaphthoquinonesBenzoquinones

Heterodimer Studies:

Creating and purifying heterodimers containing one wild-type and one mutant subunit allows examination of subunit cooperativity. With two-electron acceptors, expect approximately 50% activity of the wild-type homodimer if subunits function independently. For four-electron acceptors, activity will more closely match the less efficient subunit if they function dependently .

Kinetic Parameter Analysis:

Compare Km and kcat values across different substrates. Distinct patterns in these parameters can serve as "fingerprints" for specific subunits and provide insight into their physiological roles. When analyzing kinetic data, researchers should be aware of potential limitations due to the poor aqueous solubility of quinones and constraints on NAD(P)H concentration .

What are common pitfalls in experimental design when studying NAD(P)H-quinone oxidoreductase activity?

Researchers studying NAD(P)H-quinone oxidoreductase activity should be aware of several common pitfalls:

Technical Challenges:

  • Substrate Solubility Issues:

    • Quinones often have poor aqueous solubility, limiting the concentration range for kinetic studies

    • Recommendation: Prepare quinone stocks in DMSO (typically 20 mM), keeping final DMSO concentration at or below 5% in reaction mixtures

  • NAD(P)H Concentration Constraints:

    • Must remain within the linear detection range of spectrophotometric equipment

    • Must maintain >5:1 molar ratio of NAD(P)H to quinone for accurate kinetics

    • Recommendation: Validate that measured activities are within the initial linear part of the rate curve

  • Non-Enzymatic Reactions:

    • NAD(P)H can undergo oxidation in the presence of quinones without enzyme

    • Recommendation: Always include control reactions without enzyme

Interpretation Challenges:

  • Subunit Functionality Differences:

    • Subunits may function independently with some substrates but dependently with others

    • Recommendation: Test both two-electron and four-electron acceptors when characterizing enzyme properties

  • Substrate Specificity Characterization:

    • Different NAD(P)H quinone oxidoreductases from the same organism have complementary substrate specificity profiles

    • Recommendation: Test a diverse panel of quinones to properly characterize specificity

  • Redox Potential Considerations:

    • Differences in FMN redox potential between enzyme variants can dramatically affect activity

    • Recommendation: Consider the amino acid environment around the flavin when interpreting activity differences

Being aware of these challenges and implementing appropriate controls and experimental designs will lead to more reliable and interpretable results when studying NAD(P)H-quinone oxidoreductase activity.

How should researchers interpret contradictory findings on NAD(P)H-quinone oxidoreductase function across different species?

When faced with contradictory findings on NAD(P)H-quinone oxidoreductase function across different species, researchers should consider several factors:

Evolutionary Divergence Analysis:

  • Sequence Homology Assessment:

    • The azoreductase family (which includes many NAD(P)H quinone oxidoreductases) is more extensive than originally thought due to large sequence divergence among members

    • Proteins with as little as 25-30% sequence identity may still share the same fold and similar enzymatic capabilities

    • Recommendation: Use structural homology rather than sequence identity alone to identify functionally related enzymes

  • Functional Conservation vs. Specialization:

    • Core catalytic mechanisms may be conserved while substrate preferences diverge

    • Specialized functions may evolve in response to ecological niches and metabolic demands

    • Example: In C4 plants, the NDH complex has become essential for bundle sheath cell function, while in C3 plants it may serve more accessory roles

Methodological Reconciliation:

  • Assay Conditions:

    • Different buffer systems, pH values, and temperatures can significantly affect activity measurements

    • Recommendation: Directly compare enzymes from different species under identical conditions

  • Substrate Selection:

    • Testing limited substrate panels may miss species-specific preferences

    • Recommendation: Use comprehensive substrate panels including benzoquinones, naphthoquinones, and complex quinones

Physiological Context Consideration:

  • Cellular Localization:

    • Chloroplastic vs. mitochondrial vs. cytosolic isozymes may have distinct roles

    • Recommendation: Consider subcellular localization when comparing functions across species

  • Metabolic Network Integration:

    • The same enzyme may participate in different metabolic pathways across species

    • Example: In C4 photosynthesis, NAD(P)H-quinone oxidoreductase in bundle sheath cells is critical for maintaining ATP/NADPH balance, while in C3 photosynthesis, its role may be more related to photoprotection

By considering these factors, researchers can develop more nuanced interpretations of seemingly contradictory findings and potentially uncover evolutionary adaptations in NAD(P)H-quinone oxidoreductase function.

What approaches could improve heterologous expression and functional characterization of plant NAD(P)H-quinone oxidoreductases?

Improving heterologous expression and functional characterization of plant NAD(P)H-quinone oxidoreductases requires innovative approaches:

Expression System Optimization:

  • Plant-Based Expression Systems:

    • Consider tobacco or Arabidopsis transient expression systems for plant proteins

    • Advantages: Proper post-translational modifications and cofactor incorporation

    • Implementation: Use Agrobacterium-mediated transformation with vectors containing appropriate plant promoters

  • Codon Optimization Strategies:

    • Design synthetic genes with codons optimized for the expression host

    • For chloroplastic proteins, consider chloroplast codon usage bias

    • Potential improvement: 2-5 fold increased expression yields

  • Fusion Partner Selection:

    • Test multiple fusion tags beyond standard His-tag (MBP, GST, SUMO)

    • Evaluate tag position effects (N-terminal vs. C-terminal)

    • Consider removable tags with specific proteases to obtain native protein

Functional Characterization Enhancements:

  • High-Throughput Activity Assays:

    • Develop fluorescence-based assays for increased sensitivity

    • Implementation: Monitor NAD(P)H fluorescence decrease (excitation 340 nm, emission 460 nm)

    • Advantage: Lower detection limits and reduced sample requirements

  • Protein Engineering Approaches:

    • Create chimeric proteins between different subunits to map functional domains

    • Apply alanine-scanning mutagenesis to identify critical residues

    • Potential outcome: Identification of residues determining substrate specificity

  • Reconstitution Systems:

    • Develop liposome or nanodisc-based reconstitution systems

    • Incorporate quinone substrates and electron transport chain components

    • Advantage: Study enzyme function in membrane-like environment resembling native conditions

These approaches could significantly enhance our ability to express and characterize plant NAD(P)H-quinone oxidoreductases, facilitating deeper understanding of their structure-function relationships and physiological roles.

How might understanding NAD(P)H-quinone oxidoreductase function contribute to improving crop photosynthetic efficiency?

Understanding NAD(P)H-quinone oxidoreductase function could significantly contribute to improving crop photosynthetic efficiency in several ways:

C4 Photosynthesis Engineering:

The NAD(P)H dehydrogenase (NDH) complex plays an indispensable role in C4 photosynthesis, particularly in bundle sheath cells where it supports cyclic electron flow (CEF) to generate ATP required for the C3 cycle. Research in Setaria viridis has demonstrated that plants lacking NDH show severe biomass reduction to approximately 30% of wild type . This finding has important implications for crop improvement:

  • C4 Engineering in C3 Crops:

    • Engineering fully operational NADP-ME type C4 photosynthesis into C3 plants will require upregulating NDH abundance in bundle sheath cells

    • Potential outcome: Increased assimilation rates and radiation use efficiency

    • Implementation strategy: Targeted expression of NDH components in bundle sheath cells using specific promoters

  • Optimizing Existing C4 Crops:

    • Fine-tuning NDH activity could enhance the balance between cyclic and linear electron flow

    • Potential targets: Maize, sorghum, sugarcane

    • Expected benefit: Improved photosynthetic efficiency under fluctuating light conditions

Stress Tolerance Enhancement:

NAD(P)H-quinone oxidoreductases are involved in detoxification of quinones and alternative electron transport pathways that become especially important under stress conditions:

  • Photoprotection Under High Light:

    • Overexpression of specific NAD(P)H-quinone oxidoreductase subunits could enhance excess energy dissipation

    • Potential outcome: Reduced photoinhibition and maintained photosynthetic efficiency under high light

  • Drought Response Optimization:

    • During drought, maintaining appropriate ATP/NADPH ratios becomes challenging

    • Enhanced NDH-mediated CEF could support continued carbon fixation under water limitation

    • Implementation: Drought-inducible expression of NAD(P)H-quinone oxidoreductase components

These applications demonstrate how fundamental understanding of NAD(P)H-quinone oxidoreductase function could translate into improved crop performance, particularly under environmental conditions that limit current agricultural productivity.

What emerging technologies could advance our understanding of NAD(P)H-quinone oxidoreductase subunit interactions and assembly?

Several emerging technologies hold promise for advancing our understanding of NAD(P)H-quinone oxidoreductase subunit interactions and assembly:

Structural Biology Approaches:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of large protein complexes without crystallization

    • Can capture different conformational states during enzyme catalysis

    • Application: Determine structure of intact NAD(P)H-quinone oxidoreductase complexes in different functional states

    • Expected insight: Subunit arrangement and dynamic changes during electron transfer

  • Integrative Structural Biology:

    • Combines multiple techniques (X-ray crystallography, Cryo-EM, NMR, mass spectrometry)

    • Provides complementary structural information at different resolutions

    • Application: Map interaction interfaces between different subunits

    • Implementation strategy: Cross-linking mass spectrometry to identify interacting regions

Protein Interaction Analysis:

  • Proximity Labeling Techniques:

    • Methods like BioID or APEX2 fusion proteins to biotinylate proximal proteins in vivo

    • Advantage: Captures weak or transient interactions in native cellular environment

    • Application: Identify assembly factors and auxiliary proteins involved in complex formation

    • Expected outcome: Comprehensive interaction maps of NAD(P)H-quinone oxidoreductase assembly

  • Single-Molecule FRET:

    • Measures energy transfer between fluorescently labeled subunits

    • Provides information about conformation changes and distances between subunits

    • Application: Monitor dynamic interactions between subunits during catalysis

    • Implementation: Site-specific labeling of recombinant subunits with appropriate fluorophore pairs

Genetic and Cellular Approaches:

  • Genome-wide CRISPR Screens:

    • Systematic identification of genes affecting complex assembly and function

    • Application: Discover unknown assembly factors and regulatory elements

    • Expected insight: Complete pathway for NAD(P)H-quinone oxidoreductase biogenesis

  • Live-Cell Imaging with Fluorescent Protein Fusions:

    • Visualize assembly process in real time

    • Application: Track localization and incorporation of individual subunits

    • Implementation: Multi-color labeling of different subunits to observe sequential assembly

These technologies, particularly when used in combination, could provide unprecedented insights into how NAD(P)H-quinone oxidoreductase subunits interact and assemble into functional complexes, potentially revealing new targets for engineering enhanced photosynthetic efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.