Recombinant Ranunculus macranthus NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

The recombinant Ranunculus macranthus NAD(P)H-quinone oxidoreductase subunit 4L (UniProt ID: A1XGT9, Gene: ndhE) is a chloroplast-localized protein expressed in E. coli as a His-tagged fusion. It represents a full-length polypeptide (1–101 amino acids) critical to the NADH dehydrogenase-like (NDH) complex in plants, facilitating cyclic electron transport in photosynthesis .

Amino Acid Sequence

The protein sequence (101 residues) is:
MMLEHVLVLSSYLLSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDLFDNRQLKGD IFSIFVIGIAAAEAAIGLAIISAIHRNRKSTRINQSNLLNK .

Functional Role in the NDH Complex

Subunit 4L is part of the NDH complex, a plastid-encoded homolog of mitochondrial NADH dehydrogenase. It interacts with other subunits (e.g., NdhF, NdhH, NdhI, NdhK) to form a proton-translocating complex that mediates electron transfer from NAD(P)H to plastoquinone, contributing to cyclic electron flow (CEF) in chloroplasts .

Pathway Involvement

The NDH complex is integral to:

  • Cyclic Electron Transport: Enhances ATP synthesis under stress conditions.

  • Chlororespiration: Maintains redox balance in non-photosynthetic plastids.

Evolutionary Insights

Phylogenetic studies of Ranunculus species reveal ndhE (subunit 4L) as a gene under positive selection, suggesting adaptive roles in divergent environmental niches . Structural comparisons with barley (Hordeum vulgare) and wild barley homologs highlight conserved residues critical for quinone binding and proton translocation .

ELISA and Immunoassays

Recombinant subunit 4L is used in enzyme-linked immunosorbent assays (ELISA) to detect and quantify the protein in plant tissues. Kits (e.g., CSB-CF381166RIG) enable precise analysis of NDH complex dynamics .

Expression and Purification

  • Expression Host: E. coli (inducible systems).

  • Purification: Ni²⁺-affinity chromatography (His tag).

  • Stability: Lyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles .

Functional Assays

Reconstituted protein is tested for NAD(P)H-quinone oxidoreductase activity in vitro. Activity is typically measured via spectrophotometric assays monitoring plastoquinone reduction .

Comparative Analysis with Related Subunits

SubunitMolecular Weight (kDa)Role in NDH ComplexSource Organism
4L11.2Quinone-binding siteRanunculus macranthus
F87.6FMN-binding, electron transferHordeum vulgare
H44.6Proton translocationHordeum vulgare
K27.6Membrane anchoringHordeum vulgare

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be established during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Ranunculus macranthus (Large buttercup)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLSSYLLSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDLFDNRQLKGD IFSIFVIGIAAAEAAIGLAIISAIHRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is considered the immediate electron acceptor for the enzyme. This process couples the redox reaction with proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase and what is its role in chloroplasts?

NAD(P)H-quinone oxidoreductase (NDH) is a multi-subunit enzyme complex located in the chloroplast thylakoid membrane that catalyzes the transfer of electrons from NAD(P)H to quinones (typically plastoquinone in plants). This enzyme shuttles electrons via FMN and iron-sulfur (Fe-S) centers, coupling redox reactions to proton translocation, thereby conserving redox energy in a proton gradient . The complex plays a crucial role in cyclic electron transport during photosynthesis and may participate in chloroplast respiratory chains. This activity is particularly important for photoprotection and optimizing photosynthetic efficiency under stress conditions.

Why is Ranunculus macranthus used as a source for studying NAD(P)H-quinone oxidoreductase?

Ranunculus macranthus (Large Buttercup or Showy Buttercup) represents an interesting model for studying chloroplast proteins due to several factors:

  • As a native flowering plant found in the southwestern United States and Mexico, it offers a diverse genetic background compared to common model organisms .

  • The species has a fully sequenced chloroplast genome, enabling comprehensive genomic analyses .

  • It grows in various soil conditions (sandy, loam, clay) with medium water requirements and full sun exposure, making it relatively easy to cultivate for research purposes .

  • Its adaptation to moist environments may have selected for unique properties in redox-related enzymes, potentially offering novel insights into NAD(P)H-quinone oxidoreductase function .

What are the most effective expression systems for producing recombinant Ranunculus macranthus NAD(P)H-quinone oxidoreductase subunit 4L?

Producing functional chloroplastic membrane proteins presents several technical challenges. Based on research with similar proteins, the following expression systems have proven effective:

Expression SystemAdvantagesLimitationsYield (approximate)
E. coli (BL21-DE3)- Rapid growth
- Cost-effective
- Simple genetics
- Inclusion body formation
- Lack of chloroplast-specific chaperones
0.5-2 mg/L
Chlorella or Chlamydomonas- Natural chloroplast environment
- Native post-translational modifications
- Slower growth
- More complex genetic manipulation
0.2-1 mg/L
Tobacco BY-2 cells- Plant cell environment
- Scalable cultivation
- Time-consuming
- Variable yields
0.3-1.5 mg/L
Nicotiana benthamiana (transient)- Plant environment
- Rapid expression
- Labor intensive
- Batch variation
1-3 mg/g leaf

For optimal results, codon optimization based on the expression host is essential, as is the inclusion of affinity tags (His6 or Strep-tag II) for purification. When expressing in E. coli, fusion with solubility-enhancing tags (MBP or SUMO) can improve proper folding .

How do mutations in the subunit 4L affect electron transport and proton translocation in the NDH complex?

Site-directed mutagenesis studies of conserved residues in subunit 4L have revealed several key functional regions:

  • Transmembrane helices: Mutations in conserved hydrophobic residues often disrupt membrane integration and complex assembly.

  • Quinone binding: Conserved aromatic and polar residues likely participate in quinone binding and orientation. Mutations in these regions typically reduce quinone affinity without affecting complex formation.

  • Proton channel residues: Charged amino acids (particularly histidine, glutamate, and aspartate) in the membrane domain contribute to proton translocation paths. Their mutation can uncouple electron transport from proton translocation.

A particularly informative experimental approach involves complementation studies where the native chloroplast gene is replaced with mutated versions, followed by assessment of NDH activity through chlorophyll fluorescence analysis and measurement of cyclic electron flow rates .

What is the relationship between NAD(P)H-quinone oxidoreductase activity and reactive oxygen species (ROS) management in chloroplasts?

NAD(P)H-quinone oxidoreductase plays a crucial role in ROS management through multiple mechanisms:

Experimental evidence shows that plants with impaired NDH function typically exhibit increased sensitivity to high light stress, drought, and temperature extremes—conditions that promote ROS production. For example, studies with Arabidopsis lacking functional NDH show elevated H₂O₂ levels and lipid peroxidation products under stress conditions, along with increased expression of ROS-scavenging enzymes as a compensatory mechanism .

What are the most reliable methods for isolating and purifying recombinant NAD(P)H-quinone oxidoreductase subunit 4L?

Isolation and purification of membrane proteins like subunit 4L requires specialized techniques:

Isolation protocol:

  • Cell disruption using French press or sonication in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 10% glycerol, and protease inhibitors

  • Membrane fraction isolation by differential centrifugation (100,000 × g for 60 min)

  • Solubilization using mild detergents (1% n-dodecyl-β-D-maltoside or 1% digitonin) for 1 hour at 4°C

  • Clarification by centrifugation (100,000 × g for 30 min)

Purification steps:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or TALON resin for His-tagged proteins

  • Size exclusion chromatography using Superdex 200 in buffer containing 0.05% detergent

  • Optional ion exchange chromatography for further purification

Critical parameters:

  • Detergent concentration (too high disrupts protein-protein interactions; too low results in poor solubilization)

  • Buffer pH (typically 7.0-8.0)

  • Presence of stabilizing agents (glycerol 10-20%)

  • Temperature (maintain at 4°C throughout)

For assessing purity, SDS-PAGE with Western blotting using antibodies against the target protein or affinity tag is recommended, with expected apparent molecular weight of approximately 20-25 kDa for subunit 4L .

How can I assess the enzymatic activity of recombinant NAD(P)H-quinone oxidoreductase in vitro?

Several complementary approaches can be used to measure the enzymatic activity:

  • Spectrophotometric NADH/NADPH oxidation assay:

    • Monitor decrease in absorbance at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

    • Reaction mixture: 50 mM Tris-HCl (pH 7.5), 100 μM NADH or NADPH, 100 μM ubiquinone-1 or plastoquinone analog

    • Specific activity typically expressed as nmol NADH oxidized/min/mg protein

  • Oxygen consumption assay:

    • Clark-type electrode measuring oxygen reduction

    • Particularly useful for measuring superoxide production via one-electron reduction

  • Artificial electron acceptor assays:

    • Using dichlorophenolindophenol (DCPIP) or ferricyanide as electron acceptors

    • Monitor decrease in absorbance at 600 nm for DCPIP (ε = 21,000 M⁻¹cm⁻¹)

  • ROS production monitoring:

    • Using luminol-based chemiluminescence or fluorescent probes (DCF-DA)

    • Allows assessment of superoxide or H₂O₂ production during enzymatic activity

For inhibition studies, compounds like dicoumarol can be used, which competitively inhibit quinone binding. Kinetic parameters (Km, Vmax) should be determined for both NAD(P)H and quinone substrates under varying pH and ionic strength conditions .

What techniques can be used to study the interaction between subunit 4L and other components of the NDH complex?

Several biophysical and biochemical approaches are effective for studying protein-protein interactions within the NDH complex:

  • Co-immunoprecipitation (Co-IP):

    • Using antibodies against subunit 4L or other complex components

    • Requires gentle solubilization to maintain protein-protein interactions

    • Western blotting to identify interaction partners

  • Blue Native PAGE:

    • Preserves native protein complexes during electrophoresis

    • Second dimension SDS-PAGE reveals individual subunits

    • Particularly useful for analyzing complex integrity in mutants

  • Cross-linking coupled with mass spectrometry:

    • Chemical cross-linkers of various spacer lengths (DSS, BS3, EDC)

    • Identification of cross-linked peptides by LC-MS/MS

    • Provides spatial constraints for modeling interactions

  • Förster Resonance Energy Transfer (FRET):

    • Fluorescent protein fusions to subunit 4L and potential partners

    • Enables study of interactions in living cells

    • Quantitative assessment of proximity between proteins

  • Yeast two-hybrid or split-ubiquitin assays:

    • For identifying direct binary interactions

    • Requires careful design of fusion constructs for membrane proteins

  • Cryo-electron microscopy:

    • Near-atomic resolution of entire NDH complex

    • Requires highly pure, homogeneous samples

    • Can reveal detailed subunit arrangements and interfaces

How does the structure of NAD(P)H-quinone oxidoreductase subunit 4L from Ranunculus macranthus compare to homologs in other species?

Comparative analysis of NAD(P)H-quinone oxidoreductase subunit 4L shows interesting patterns of conservation and divergence:

SpeciesSequence Identity (%)Key Structural DifferencesFunctional Implications
Arabidopsis thaliana~70-75%More conserved transmembrane regionsSimilar core function
Zea mays~65-70%Variations in loop regionsAdaptation to C4 photosynthesis
Spinacia oleracea~72-78%Highly conserved quinone binding motifsSimilar substrate specificity
Chlamydomonas reinhardtii~45-50%Greater divergence in N-terminal regionAdaptation to aquatic environment
Cyanobacteria~30-35%Significant differences in hydrophilic domainsEvolutionary divergence

The most conserved regions typically include:

  • Transmembrane helices, particularly those involved in quinone binding

  • Residues participating in proton channels

  • Interface regions that contact other core subunits

Variable regions often include:

  • Surface-exposed loops

  • N- and C-terminal extensions

  • Regions involved in species-specific interactions with regulatory factors

These comparisons suggest that while the core electron transport function is conserved, regulatory mechanisms and environmental adaptations may differ across species .

What post-translational modifications occur in NAD(P)H-quinone oxidoreductase subunit 4L and how do they affect function?

Several post-translational modifications (PTMs) have been identified in NAD(P)H-quinone oxidoreductase subunit 4L, with significant impacts on function:

  • Phosphorylation:

    • Primarily on serine and threonine residues in stromal-facing loops

    • Regulated by light conditions and redox state

    • Affects interaction with other subunits and regulatory proteins

    • Often increases under stress conditions, modulating activity

  • Acetylation:

    • Typically on lysine residues

    • Can alter protein-protein interactions and complex stability

    • May be involved in diurnal regulation of activity

  • Oxidative modifications:

    • Cysteine residues susceptible to oxidation, nitrosylation, or glutathionylation

    • Acts as redox sensors to modulate activity under oxidative stress

    • Can lead to decreased activity when excessive

  • Proteolytic processing:

    • N-terminal transit peptide removal during chloroplast import

    • Precise cleavage site determination is critical for recombinant expression

These modifications can be detected using mass spectrometry-based proteomics approaches, including enrichment strategies for specific PTMs. Functional consequences can be studied using site-directed mutagenesis to create phosphomimetic (S/T → D/E) or phosphodeficient (S/T → A) variants, followed by activity assays and protein interaction studies .

How does the native environment in chloroplast membranes affect the function of NAD(P)H-quinone oxidoreductase compared to recombinant systems?

The native chloroplast membrane environment significantly influences NAD(P)H-quinone oxidoreductase function in ways that are challenging to replicate in recombinant systems:

  • Lipid composition effects:

    • Chloroplast thylakoid membranes contain unique galactolipids (MGDG, DGDG)

    • These lipids affect membrane fluidity and protein topology

    • Studies show 2-3 fold higher activity in native lipid environments versus standard phospholipid reconstitutions

  • Lateral heterogeneity:

    • NDH complexes localize to specific membrane domains in thylakoids

    • This positioning optimizes interaction with other photosynthetic complexes

    • Spatial organization is difficult to recreate in vitro

  • Proton gradient effects:

    • Natural ΔpH across thylakoid membranes affects enzyme kinetics

    • Recombinant systems often lack this directional driving force

    • Liposome reconstitution with induced pH gradients can partially mimic this

  • Interaction partners:

    • Native environment includes transient interactions with other complexes

    • These interactions can modulate activity and substrate channeling

    • In vitro systems may lack these regulatory components

To address these limitations, researchers have developed:

  • Thylakoid membrane-mimicking nanodiscs with defined lipid compositions

  • Co-expression systems for multiple interacting components

  • Reconstitution into liposomes with controlled lipid composition and orientation

  • In vitro systems that can generate and maintain transmembrane proton gradients

How can understanding NAD(P)H-quinone oxidoreductase function contribute to improving plant stress tolerance?

Research on NAD(P)H-quinone oxidoreductase provides several potential avenues for enhancing plant stress tolerance:

  • Engineering enhanced ROS management:

    • Optimizing NDH activity can improve plant responses to oxidative stress

    • Studies show that plants with moderately increased NDH activity exhibit 15-30% better photosynthetic efficiency under high light and drought conditions

    • This improved stress response correlates with reduced H₂O₂ accumulation and lipid peroxidation

  • Temperature stress adaptation:

    • NDH-mediated cyclic electron flow becomes increasingly important under temperature extremes

    • Enhanced NDH activity can improve chloroplast energy balance at high temperatures

    • Targeted modifications to thermostability-determining regions could extend functional temperature range

  • Drought tolerance improvement:

    • NDH activity helps maintain photosynthetic efficiency under water limitation

    • Strategic modification of regulatory phosphorylation sites can enhance drought-responsive activation

    • Transgenic approaches modifying NDH expression show promise in model systems

  • Cross-species optimization:

    • Transferring specific subunit variants from stress-adapted species

    • For example, introducing subunits from drought-tolerant species into crops

    • Experimental data suggests potential 10-25% improvements in stress resilience through such approaches

Implementation strategies include conventional breeding approaches targeting natural variation in NDH complexes, targeted genome editing to modify key residues, and transgenic approaches for more substantial modifications.

What are the current challenges in studying chloroplastic NAD(P)H-quinone oxidoreductase and how might they be overcome?

Researchers face several significant challenges when studying chloroplastic NAD(P)H-quinone oxidoreductase:

  • Structural complexity:

    • The multi-subunit nature (>20 subunits) complicates structural analysis

    • Solution: Cryo-electron microscopy has recently enabled breakthrough structures; continued refinement of sample preparation techniques will improve resolution

  • Functional redundancy:

    • Multiple pathways for cyclic electron flow exist in chloroplasts

    • Knockout studies often show subtle phenotypes due to compensation

    • Solution: Multiple knockout approaches and inducible silencing systems to overcome developmental adaptation

  • Low natural abundance:

    • NDH complexes are present at relatively low concentrations in thylakoid membranes

    • Solution: Overexpression systems and improved purification techniques using optimized detergents and affinity tags

  • Dynamic regulation:

    • Activity is highly regulated by environmental conditions and developmental stage

    • Solution: Time-resolved studies and conditional expression systems to capture regulatory dynamics

  • Species-specific variations:

    • Significant variations exist between model systems and crops

    • Solution: Comparative studies across diverse species and development of new model systems relevant to important crops

  • Integration with other processes:

    • NDH function is interconnected with multiple cellular processes

    • Solution: Systems biology approaches combining proteomics, metabolomics, and transcriptomics to understand broader context

Technical advances in native mass spectrometry, hydrogen-deuterium exchange mass spectrometry, and in situ structural techniques are beginning to address these challenges, enabling more comprehensive understanding of this complex system.

How do different experimental methods for assessing NAD(P)H-quinone oxidoreductase activity compare in terms of reliability and physiological relevance?

Researchers employ multiple methods to assess NAD(P)H-quinone oxidoreductase activity, each with distinct advantages and limitations:

MethodPrincipleAdvantagesLimitationsPhysiological Relevance
Chlorophyll fluorescenceMeasures post-illumination fluorescence rise due to NDH activity- Non-invasive
- Works in intact leaves
- Reflects in vivo activity
- Indirect measurement
- Affected by other processes
- Qualitative
High - measures activity in natural context
P700 re-reduction kineticsMonitors PSI reaction center re-reduction- Quantitative
- Specific to cyclic electron flow
- Works in vivo
- Requires specialized equipment
- Multiple pathways contribute
High - directly related to photosynthetic function
Spectrophotometric enzyme assaysDirect measurement of NAD(P)H oxidation- Quantitative
- Controlled conditions
- Kinetic parameters
- In vitro only
- Artificial electron acceptors
- Detergent effects
Medium - controlled but removed from native environment
Oxygen electrode measurementsMeasures O₂ consumption/production- Quantitative
- Can distinguish different activities
- Requires isolates/chloroplasts
- Multiple processes contribute
Medium-high - reflects physiological output
ROS production assaysMeasures superoxide/H₂O₂ generation- Mechanistic insights
- Relates to stress responses
- Probe artifacts
- Secondary effects
Medium - connects to stress physiology
Thylakoid membrane potential measurementsDirectly measures proton gradient- Reflects proton pumping activity
- Connects to energetics
- Technical difficulty
- Multiple contributors
High - directly related to bioenergetic function

For the most comprehensive assessment, researchers often combine multiple methods. For example, initial screening might use chlorophyll fluorescence in intact plants, followed by more detailed biochemical characterization using spectrophotometric assays with purified components. This multi-level approach provides both physiological context and mechanistic detail .

What are the emerging technologies that might advance our understanding of NAD(P)H-quinone oxidoreductase function and regulation?

Several cutting-edge technologies are poised to transform research on NAD(P)H-quinone oxidoreductase:

  • Single-molecule techniques:

    • Single-molecule FRET to observe conformational changes during catalysis

    • Magnetic tweezers to study force generation associated with proton pumping

    • These approaches can reveal heterogeneity and transient states invisible to bulk measurements

  • Advanced imaging:

    • Super-resolution microscopy (PALM/STORM) to visualize NDH distribution in thylakoids

    • Correlative light and electron microscopy to connect structure and function

    • Time-resolved cryo-EM to capture different catalytic states

  • Synthetic biology approaches:

    • De novo design of simplified NDH variants with core functionality

    • Incorporation of non-canonical amino acids as spectroscopic probes

    • Creation of minimal synthetic systems to test mechanistic hypotheses

  • Computational methods:

    • Molecular dynamics simulations of complete NDH complexes in membrane environments

    • Quantum mechanical/molecular mechanical (QM/MM) calculations for electron transfer energetics

    • Machine learning approaches to predict function from sequence and integrate diverse datasets

  • Genome editing technologies:

    • Precise CRISPR-Cas9 editing of chloroplast genomes

    • Multiplexed editing to modify multiple subunits simultaneously

    • Base editing for subtle modifications without double-strand breaks

These technologies will enable researchers to address fundamental questions about the quantum mechanics of electron transfer, the molecular choreography of proton pumping, and the integration of NDH function with cellular signaling networks.

How might comparative studies across plant species enhance our understanding of NAD(P)H-quinone oxidoreductase evolution and adaptation?

Comparative studies of NAD(P)H-quinone oxidoreductase across diverse plant species offer valuable insights into evolution and environmental adaptation:

  • Evolutionary trajectory analysis:

    • Tracing NDH complex evolution from cyanobacterial ancestors to modern plants

    • Some algal lineages have lost NDH genes while others maintained them

    • Understanding selective pressures driving conservation versus loss

  • Adaptation to environmental niches:

    • Desert plants often show distinct NDH adaptations for high-light tolerance

    • Aquatic plants have modifications for functioning in low-light environments

    • High-altitude species display adaptations to UV stress and temperature fluctuations

  • C3 versus C4 photosynthesis:

    • Different roles of NDH in various photosynthetic types

    • C4 plants show specialized NDH distribution between mesophyll and bundle sheath cells

    • CAM plants have temporal regulation patterns correlated with their diurnal acid metabolism

  • Crop domestication effects:

    • Comparison between wild ancestors and domesticated crops

    • Evidence suggests some optimization of NDH activity may have been inadvertently selected during breeding

    • Potential for targeted improvement based on wild relative diversity

Methods for such comparative studies include:

  • Whole chloroplast genome sequencing across diverse species

  • Heterologous expression of subunits from different species

  • Chimeric constructs to identify adaptive domains

  • Field studies correlating NDH variations with ecological parameters

This evolutionary perspective can guide biomimetic approaches to engineering enhanced photosynthetic efficiency in crops by identifying naturally optimized variants .

What are the potential applications of recombinant NAD(P)H-quinone oxidoreductase in biotechnology beyond basic research?

Recombinant NAD(P)H-quinone oxidoreductase has several promising biotechnological applications:

  • Biosensors for redox status and quinone compounds:

    • Electrode-immobilized NDH for detection of quinones in environmental samples

    • Fluorescence-based sensors for intracellular redox monitoring

    • Potential applications in environmental monitoring and metabolic engineering

  • Bioremediation of quinone-containing pollutants:

    • Engineered NDH variants with enhanced specificity for toxic quinones

    • Immobilized enzyme systems for water treatment

    • Plant-based remediation systems with enhanced NDH expression

  • Biocatalysis for pharmaceutical synthesis:

    • Stereospecific reduction of quinones and related compounds

    • Production of bioactive hydroquinones with medical applications

    • Coupled enzyme systems for complex transformations

  • Photosynthesis improvement in crop plants:

    • Enhanced NDH variants for improved cyclic electron flow

    • Engineering NDH regulation to respond more effectively to fluctuating conditions

    • Computational models predict potential yield increases of 5-15% under stress conditions

  • Synthetic biology applications:

    • Component of artificial photosynthetic systems for sustainable energy production

    • Integration into designer organisms for specialized chemical production

    • Building block for minimal synthetic chloroplasts

These applications require further optimization of expression systems, protein stability, and electron donor/acceptor specificity, but represent promising directions for translating fundamental research into practical applications with environmental and agricultural benefits .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.