Recombinant Ranunculus macranthus NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

NDH (NAD(P)H dehydrogenase) complexes in chloroplasts mediate electron transfer from NAD(P)H to plastoquinone, contributing to:

  • Photosynthetic cyclic electron flow: Maintains ATP/NADPH balance during light reactions .

  • Chlororespiration: Protects against oxidative stress by regulating plastoquinone redox state .

The subunit 6 (ndhG) forms part of the membrane-bound NDH complex, facilitating proton translocation across thylakoid membranes to establish electrochemical gradients .

Recombinant Production and Applications

Expression system:

  • Produced in E. coli with N-terminal His-tags for affinity chromatography .

Research applications:

  • Mechanistic studies: Elucidate electron transfer kinetics and inhibitor interactions .

  • Photosynthesis engineering: Optimize chloroplast redox balance in crops .

  • Structural biology: Cryo-EM and X-ray crystallography to resolve conformational dynamics .

Comparative Analysis Across Species

OrganismNDH Subunit 6 FeaturesReference
Arabidopsis thaliana45 kDa, interacts with PSI-NDH supercomplex
E. coliLacks proton-pumping capability
Synechocystis sp.Three NdhG homologs (NdbA/B/C)

The Ranunculus macranthus enzyme shares evolutionary conservation with cyanobacterial and plant homologs but exhibits unique adaptations in cofactor binding .

Challenges and Future Directions

  • Stability issues: Repeated freeze-thaw cycles degrade activity; single-use aliquots recommended .

  • Unresolved mechanisms: Communication between active sites in homodimers remains poorly understood .

Recent studies focus on engineering thermostable variants and exploring roles in stress tolerance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Ranunculus macranthus (Large buttercup)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDFLLVFLGLGFIMGGLGVVLLTNPIFSAFSLGLVLVCTSLFYTPSNSHFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYSDFHLWTVGDGVTSLVCTSIFVSLITTIPDTSW YGIVWTTRSNQIIEQDLINNSQQIGIHLSTDFFLPFELISIILLVALIGAISMARQY
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant NAD(P)H-quinone oxidoreductase proteins?

For optimal stability and activity retention, recombinant NAD(P)H-quinone oxidoreductase should be stored in the following conditions:

  • Primary storage: -20°C for regular use or -80°C for extended storage

  • Buffer system: Tris-based buffer containing 50% glycerol, specifically optimized for protein stability

  • Working aliquots: Can be stored at 4°C for up to one week to minimize freeze-thaw cycles

  • Freeze-thaw considerations: Repeated freezing and thawing is not recommended as it can significantly reduce enzyme activity

This storage protocol is similar to other recombinant proteins such as UBE1, which is also stored with protective agents to enhance stability .

How are chloroplastic NAD(P)H-quinone oxidoreductases structurally organized?

NAD(P)H-quinone oxidoreductases typically display a bi-modular architecture, with specific domains dedicated to different functions:

  • NADPH-binding groove: Structured to accommodate the NADPH cofactor

  • Substrate-binding pocket: Configured to interact with quinone substrates

  • Quaternary structure: Often functions as a tetramer in solution, as demonstrated by gel filtration and ultracentrifugation analyses of related proteins

  • Dimeric interface: Typically mediated by amino acids from β-sheets, α-helices, and connecting loops

The enzyme's active sites vary among homologues, indicating differences in substrate specificities. For instance, the NADPH-dependent QOR from Phytophthora capsici (PcQOR) tends to catalyze reactions with larger substrates like 9,10-phenanthrenequinone .

What is the enzymatic function of NAD(P)H-quinone oxidoreductase in chloroplasts?

NAD(P)H-quinone oxidoreductase in chloroplasts catalyzes the transfer of electrons from NAD(P)H to quinones, serving several critical functions:

  • Electron transport: Facilitates electron flow within the chloroplast electron transport chain

  • Detoxification: Assists in detoxifying harmful chemicals and xenobiotics

  • Redox balance: Maintains appropriate redox conditions within the chloroplast

  • Energy metabolism: Contributes to cellular energy production through its role in electron transport

This enzymatic activity likely helps plants like Ranunculus macranthus to neutralize potentially harmful chemicals encountered in their environment, similar to how the related enzyme in Phytophthora capsici helps detoxify harmful chemicals during host invasion .

What computational approaches can be used to identify quinone-binding sites in NAD(P)H-quinone oxidoreductases?

Advanced computational approaches for identifying quinone-binding sites in oxidoreductases involve multiple complementary techniques:

  • Structure-based simulation: Molecular dynamics simulations can reveal potential binding channels for quinones. These simulations should include both the enzyme and cofactor (NADPH) to accurately model the ternary complex formation.

  • Site-directed mutagenesis validation: Computational predictions should be verified through experimental mutagenesis of predicted binding site residues. For example, in PcQOR, mutations of specific residues in the potential quinone-binding channel significantly affected enzyme activity .

  • Sequence conservation analysis: Comparing sequences across species can identify conserved residues likely involved in substrate binding. For Ranunculus macranthus, alignment with homologous structures can reveal conserved topology while highlighting differences in substrate-binding regions .

  • Docking simulations: Virtual screening of various quinone substrates can predict binding affinities and orientations.

Computational MethodApplication to NAD(P)H-QORKey Outputs
Molecular dynamicsIdentifies dynamic binding channelsPotential entry pathways for substrates
Conservation analysisHighlights functionally important residuesResidues likely involved in catalysis
Docking simulationsPredicts substrate specificityBinding energies and orientations
Electrostatic surface mappingReveals charge distributionPotential interaction sites for charged substrates

In related research, computational simulation combined with site-directed mutagenesis identified a potential quinone-binding site in PcQOR where the substrate is positioned by side chains of specific residues (R45, Q48, Y54, C147, and T148) and the NADPH nicotinamide ring .

How does the quaternary structure of NAD(P)H-quinone oxidoreductases influence catalytic activity?

The quaternary structure of NAD(P)H-quinone oxidoreductases plays a crucial role in their catalytic function through several mechanisms:

  • Active site formation: In many NAD(P)H-quinone oxidoreductases, the active site is formed at the interface between subunits. For example, in PcQOR, the dimeric interface involves amino acids from β13-sheet, α7-helix, and loops between α7 and α8, creating an interface area of 983.3 Å with a ΔiG of -14.5 kcal/mol .

  • Cofactor stabilization: Residues from adjacent monomers often interact with the nicotinamide moiety of NADPH. In PcQOR, L282 from α7 of one monomer interacts with Q292 of the adjacent monomer, positioning them in close proximity to the nicotinamide moiety of NADPH .

  • Substrate channel formation: The quaternary arrangement creates channels through which substrates access the active site. Disruption of these channels through mutations or conformational changes can significantly alter enzyme activity.

  • Allosteric regulation: The tetrameric structure observed in solution for some NAD(P)H-quinone oxidoreductases may enable cooperative binding and allosteric regulation.

Research on related proteins shows that dimerization is essential for stabilizing the boundary of the active site, with interactions between specific residues (I283, C286, L288, Q292, G290) from adjacent monomers being indispensable for maintaining proper enzyme function .

What methodologies are most effective for studying the catalytic mechanism of chloroplastic NAD(P)H-quinone oxidoreductases?

Investigating the catalytic mechanism of chloroplastic NAD(P)H-quinone oxidoreductases requires an integrated experimental approach:

  • Crystallography with bound ligands: Obtaining crystal structures with both NADPH and substrate analogs can reveal the spatial arrangement of the ternary complex. The 2.4 Å resolution structure of PcQOR with NADPH provided valuable insights into cofactor binding and potential substrate interactions .

  • Stopped-flow kinetics: This technique allows measurement of reaction rates on millisecond timescales, essential for observing electron transfer events.

  • Site-directed mutagenesis: Systematic mutation of active site residues can identify those critical for substrate binding versus catalysis. For Ranunculus macranthus NAD(P)H-quinone oxidoreductase, mutations of residues corresponding to those identified in homologous enzymes would be informative.

  • Spectroscopic techniques: UV-visible, fluorescence, and EPR spectroscopy can track changes in the redox state of the enzyme, cofactor, and substrate during catalysis.

  • Substrate specificity profiling: Testing activity with various quinone substrates can reveal structure-activity relationships. PcQOR showed preference for larger substrates like 9,10-phenanthrenequinone .

Based on studies of related enzymes, a likely catalytic mechanism involves:

  • Substrate entry into the active pocket

  • Redistribution by key residues (corresponding to R45, Q48, Y54, C147, and T148 in PcQOR)

  • Positioning of the quinone phenyl ring against the nicotinamide ring

  • Electron transfer facilitated by the hydrophobic environment around the positively charged nicotinamide

  • Product release as hydrogen bonds between quinone and key residues break

How can tandem repeat sequences in chloroplast genomes be utilized for authentication of plant materials containing NAD(P)H-quinone oxidoreductases?

Tandem repeat sequences in chloroplast genomes offer valuable tools for authenticating plant materials through several methodological approaches:

  • Development of indel markers: Tandem repeats, particularly those in intergenic regions like rps16-trnQ-UUG, can be developed into insertion/deletion (indel) markers for species identification. This approach has been successfully used to identify authentic Cimicifugae Rhizoma, and similar methods could be applied to Ranunculus species .

  • Species-specific fingerprinting: Chloroplast genome analysis of Ranunculus species can reveal unique tandem repeat patterns:

    • Length variations: Tandem repeats typically range from 8-46 bp

    • Copy number variations: Usually present as 2-4 copies

    • Distribution patterns: Majority located in the Large Single Copy (LSC) region

  • PCR-based authentication protocols: Primers designed to flank variable tandem repeat regions can amplify fragments of different sizes, allowing for rapid identification of plant material.

  • Next-generation sequencing applications: Whole chloroplast genome sequencing can provide comprehensive tandem repeat profiles for definitive authentication.

While not directly addressing NAD(P)H-quinone oxidoreductase, these genomic approaches provide powerful tools for ensuring the correct botanical identity of research materials, which is critical when studying specific enzymes from particular plant species.

What are the challenges in expressing and purifying functional recombinant NAD(P)H-quinone oxidoreductases for structural studies?

Producing high-quality recombinant NAD(P)H-quinone oxidoreductases for structural studies presents several challenges that require specific methodological solutions:

  • Expression system selection: Choosing an appropriate heterologous expression system is critical. While bacterial systems offer high yields, insect cell systems (such as Sf21 baculovirus systems used for other complex proteins) may provide better folding and post-translational modifications for plant proteins .

  • Protein solubility: NAD(P)H-quinone oxidoreductases can form inclusion bodies when overexpressed. Solutions include:

    • Fusion tags: Adding solubility-enhancing tags such as MBP or SUMO

    • Co-expression with chaperones to assist proper folding

    • Optimization of induction conditions (temperature, inducer concentration)

  • Cofactor incorporation: Ensuring proper incorporation of NADPH during purification may be necessary for structural stability.

  • Maintaining quaternary structure: Given the importance of quaternary structure to function, purification conditions must preserve native oligomeric states (dimeric or tetrameric). Techniques like size exclusion chromatography and analytical ultracentrifugation are essential for verifying the correct assembly .

  • Functional validation: Activity assays using model substrates should confirm that the purified protein is catalytically competent.

  • Crystallization challenges: For structural studies, protein heterogeneity can hinder crystallization. Techniques employed successfully for related proteins include:

    • Screening multiple constructs with varying N- and C-terminal boundaries

    • Surface entropy reduction through mutation of surface residues

    • Co-crystallization with substrates or substrate analogs

Current Research Gaps and Future Directions

Research on Ranunculus macranthus NAD(P)H-quinone oxidoreductase remains an evolving field with several important knowledge gaps and opportunities:

  • Comparative structural studies: While structures exist for related NAD(P)H-quinone oxidoreductases, such as that from Phytophthora capsici, direct structural characterization of the Ranunculus macranthus enzyme would provide valuable insights into plant-specific features .

  • Physiological roles: The specific ecological and physiological significance of NAD(P)H-quinone oxidoreductase in Ranunculus species requires further investigation, particularly in relation to environmental adaptation and stress responses.

  • Substrate specificity determinants: Detailed understanding of the structural features determining substrate preferences would advance our knowledge of how these enzymes evolved different specificities across species.

  • Integration with chloroplast function: Studies exploring how NAD(P)H-quinone oxidoreductases integrate with other chloroplast systems would provide a more comprehensive picture of their role in plant metabolism.

  • Application potential: The detoxification capabilities of these enzymes suggest potential biotechnological applications that remain to be fully explored.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.