Recombinant Raphanus sativus NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested and pre-arranged (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Raphanus sativus (Radish)
Target Names
ND3
Target Protein Sequence
MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIR FYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE
Uniprot No.

Target Background

Function

Recombinant Raphanus sativus NADH-ubiquinone oxidoreductase chain 3 (ND3)

A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), ND3 is considered part of the minimal assembly required for catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the amino acid sequence and structural characteristics of Raphanus sativus ND3?

The amino acid sequence of Raphanus sativus ND3 is:
MmLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE

This protein is a mitochondrial membrane-bound component of Complex I (NADH dehydrogenase) with hydrophobic domains. Its structural characteristics include transmembrane regions that anchor it within the inner mitochondrial membrane, where it participates in electron transfer from NADH to ubiquinone.

What are the optimal storage and handling conditions for recombinant Raphanus sativus ND3?

For optimal preservation of recombinant Raphanus sativus ND3:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles

  • Store working aliquots at 4°C for up to one week

  • Use a Tris-based buffer with 50% glycerol for storage

These conditions maintain protein stability and prevent degradation. When handling the protein, minimize exposure to room temperature and keep on ice during experimental procedures to preserve enzymatic activity.

How can researchers effectively isolate and purify native ND3 from Raphanus sativus tissues?

Isolation of native ND3 from Raphanus sativus requires specialized techniques for membrane proteins:

  • Tissue preparation: Harvest fresh radish taproots and remove extraneous tissues.

  • Homogenization: Grind tissues in liquid nitrogen followed by homogenization in isolation buffer (typically containing sucrose, EDTA, and protease inhibitors).

  • Differential centrifugation: Perform sequential centrifugation to isolate mitochondria (10,000g for crude mitochondria, followed by purification on sucrose gradients).

  • Membrane protein extraction: Solubilize mitochondrial membranes using mild detergents such as n-dodecyl-β-D-maltoside or digitonin.

  • Chromatographic separation: Purify ND3 using ion exchange chromatography followed by affinity or size exclusion chromatography.

This approach must be adapted to the high aqueous environment needed for maintaining membrane protein stability, similar to the analytical extraction techniques discussed for other radish bioactive compounds .

What are the key considerations when designing activity assays for Raphanus sativus ND3?

When designing activity assays for ND3, researchers should consider:

  • Electron donor/acceptor pairs: Use NADH as the physiological electron donor and ubiquinone analogs (CoQ1 or decylubiquinone) as acceptors.

  • Spectrophotometric monitoring: Track NADH oxidation at 340 nm or ubiquinone reduction at 275-280 nm.

  • Inhibitor controls: Include rotenone as a specific Complex I inhibitor to distinguish ND3-specific activity.

  • Buffer optimization: Test various pH conditions (typically pH 7.2-7.8) and ionic strengths.

  • Detergent selection: Use detergents that maintain protein activity while ensuring solubility (typically at concentrations below their critical micelle concentration).

  • Temperature control: Maintain consistent temperature (usually 25-30°C) throughout measurements.

These considerations help ensure that the observed activity reflects the true catalytic properties of ND3 within the Complex I assembly.

How can researchers investigate the relationship between ND3 function and antioxidant properties in different Raphanus sativus cultivars?

To investigate the relationship between ND3 function and antioxidant properties:

  • Cultivar selection: Choose diverse radish cultivars with known differences in antioxidant properties, such as Seo Ho, Man Tang Hong, and Hong Peng No. 1 as described in metabolic profiling studies .

  • ND3 activity measurement: Quantify Complex I activity in mitochondrial preparations from each cultivar.

  • ROS production assessment: Measure superoxide and hydrogen peroxide production from isolated mitochondria.

  • Antioxidant capacity correlation: Compare ND3 activity with antioxidant capacity using standardized assays:

    • Superoxide radical scavenging activity

    • DPPH assay

  • Metabolomic integration: Correlate findings with metabolomic profiles, particularly focusing on secondary metabolites marked in dotted boxes in correlation matrices .

Analysis should employ multivariate statistical approaches similar to the PCA analysis used in metabolic profiling of radish cultivars to identify potential correlations between ND3 activity, ROS generation, and antioxidant capacity.

What methods can be employed to study post-translational modifications of Raphanus sativus ND3?

To study post-translational modifications (PTMs) of Raphanus sativus ND3:

  • Mass spectrometry approaches:

    • Bottom-up proteomics: Enzymatic digestion followed by LC-MS/MS

    • Top-down proteomics: Analysis of intact protein

    • Targeted MS: Multiple reaction monitoring for specific modifications

  • Modification-specific techniques:

    • Phosphorylation: Pro-Q Diamond staining, phospho-specific antibodies

    • Oxidative modifications: OxyBlot, biotin-switch technique

    • Acetylation: Acetylation-specific antibodies

  • Functional correlation:

    • Site-directed mutagenesis of modified residues

    • Activity assays comparing native and modified forms

    • Structural studies via homology modeling based on known Complex I structures

This methodological approach allows researchers to identify how PTMs might regulate ND3 function within Complex I and potentially adapt to different metabolic states in the plant.

How does Raphanus sativus ND3 compare to homologous proteins in related Brassicaceae species?

Comparative analysis of ND3 across Brassicaceae should consider:

  • Sequence alignment: Align ND3 sequences from radish (P68159) with those from related species such as Brassica rapa.

  • Evolutionary analysis: Conduct phylogenetic studies considering the genome rearrangements known to occur in Brassicaceae .

  • Structural comparison: Create homology models based on the 119-amino acid expression region to identify conserved functional domains.

  • Genomic context: Analyze the gene neighborhood and organization, accounting for the genome rearrangements in radish compared to other Brassicaceae species .

The analysis should account for the fact that "radish (Raphanus sativus L., n = 9) is one of the major vegetables in Asia" and that "the genomes of Brassica and related species including radish underwent genome rearrangement" , which can influence the evolution and function of proteins like ND3.

What functional differences might exist between ND3 from different Raphanus sativus cultivars?

To investigate functional differences in ND3 across radish cultivars:

  • Sequence comparison: Analyze ND3 sequences from multiple cultivars to identify polymorphisms.

  • Expression analysis: Quantify ND3 transcript and protein levels across cultivars using RT-qPCR and western blotting.

  • Enzyme kinetics: Compare Michaelis-Menten parameters (Km, Vmax) for NADH oxidation and ubiquinone reduction.

  • Stress response patterns: Examine ND3 activity under various stressors across cultivars.

  • Integration with metabolomics: Correlate functional differences with metabolic profiles similar to those generated for different radish cultivars .

ParameterAnalysis MethodExpected Outcomes
Sequence variationDNA sequencingSNPs in coding/regulatory regions
Expression levelsRT-qPCR, Western blotQuantitative differences between cultivars
Enzyme kineticsSpectrophotometric assaysVariations in Km, Vmax, catalytic efficiency
Stress responseActivity assays under stress conditionsDifferential sensitivity to environmental factors
Metabolic impactCorrelation with metabolomic dataAssociations with specific metabolic pathways

What are common challenges in recombinant expression of Raphanus sativus ND3 and how can they be addressed?

Common challenges and solutions for recombinant ND3 expression:

  • Protein misfolding: Use specialized expression systems for membrane proteins:

    • Cell-free systems with membrane mimetics

    • Bacterial strains optimized for membrane proteins (C41, C43)

    • Fusion tags that enhance solubility (MBP, SUMO)

  • Low expression yields:

    • Optimize codon usage for expression host

    • Test different promoter strengths

    • Evaluate expression temperature (typically lower temperatures improve folding)

    • Use enriched media formulations

  • Protein degradation:

    • Include protease inhibitors throughout purification

    • Test different detergent types and concentrations

    • Optimize buffer conditions based on stability studies

  • Activity loss during purification:

    • Maintain consistent detergent concentration above CMC

    • Include stabilizing lipids in purification buffers

    • Consider purifying as part of a larger complex rather than isolated subunit

These approaches address the challenges inherent in working with membrane proteins like ND3, which require specialized handling due to their hydrophobic nature.

How can researchers validate the structural integrity and functional activity of purified recombinant ND3?

Validation approaches for recombinant ND3:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to verify secondary structure

    • Size exclusion chromatography to confirm monodispersity

    • Thermal shift assays to assess stability

    • Limited proteolysis to verify proper folding

  • Functional validation:

    • NADH:ubiquinone oxidoreductase activity assays

    • Inhibitor sensitivity profiles (rotenone, piericidin A)

    • Reconstitution into liposomes to measure membrane potential generation

    • ROS production measurement as a functional readout

  • Integration assessment:

    • Co-immunoprecipitation with other Complex I subunits

    • Blue native PAGE to verify complex assembly

    • Crosslinking studies to confirm proper subunit interactions

These methodologies provide complementary information about both the structural integrity and functional competence of the recombinant protein.

How might ND3 function relate to the bioactive compounds and medicinal properties of Raphanus sativus?

The relationship between ND3 function and bioactive compounds in radish can be investigated through:

  • Mitochondrial energy status and secondary metabolism:

    • ND3/Complex I function affects ATP production and cellular redox state

    • These parameters influence biosynthetic pathways for bioactive compounds

    • Particularly relevant for isothiocyanates (ITCs) formed after glucosinolate-myrosinase enzymolysis

  • Oxidative stress signaling:

    • Complex I (including ND3) is a major site of ROS production

    • ROS act as signaling molecules affecting secondary metabolite biosynthesis

    • This may influence the production of compounds like raphasatin, which showed high bioaccessibility in digestion studies

  • Metabolic rewiring under stress:

    • ND3 dysfunction could trigger metabolic adaptations

    • These adaptations may enhance production of protective compounds

    • Could explain variations in antioxidant profiles across different radish cultivars

Research should focus on how mitochondrial function influences the formation and bioaccessibility of bioactive compounds like S-Sulforaphene and indole-3-carbinol (I3C), which showed promising phytochemical profiles due to their bioaccessibility and considerable remaining amounts after digestion .

What role might ND3 play in the adaptation of Raphanus sativus to environmental stressors?

To investigate ND3's role in stress adaptation:

  • Stress exposure experiments:

    • Subject radish plants to various stressors (drought, salinity, temperature extremes)

    • Monitor changes in ND3 expression, protein levels, and activity

    • Correlate with physiological responses and metabolite profiles

  • Regulatory network analysis:

    • Identify transcription factors controlling ND3 expression under stress

    • Map post-translational modifications triggered by stress signals

    • Determine how these modifications affect enzyme function

  • Metabolic impact assessment:

    • Measure changes in respiratory capacity and efficiency

    • Quantify altered ROS production and detoxification

    • Evaluate changes in energy-dependent stress response pathways

This research would provide insights into how mitochondrial adaptations contribute to stress tolerance in radish, potentially identifying mechanisms that could be targeted for improving crop resilience.

How can advanced imaging techniques be applied to study the subcellular localization and dynamics of ND3 in Raphanus sativus?

Advanced imaging approaches for ND3 research:

  • Super-resolution microscopy:

    • STED or PALM microscopy to visualize mitochondrial substructures

    • Track ND3 distribution within the inner mitochondrial membrane

    • Resolution of ~20-50 nm allows visualization of respiratory supercomplex arrangements

  • Live-cell imaging with fluorescent tags:

    • Generation of fluorescent protein fusions with careful design to maintain function

    • Real-time monitoring of ND3 dynamics during stress responses

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence localization with ultrastructural context

    • Immuno-electron microscopy for precise localization

    • Tomographic reconstruction of mitochondrial membrane architecture

  • Multi-parameter imaging:

    • Simultaneous monitoring of ND3 localization, mitochondrial membrane potential, and ROS production

    • Correlation with metabolic state markers

These approaches would provide unprecedented insights into the dynamic behavior of ND3 within the context of mitochondrial function and plant physiology.

What are the prospects for using CRISPR-Cas9 genome editing to study ND3 function in Raphanus sativus?

CRISPR-Cas9 applications for ND3 research:

  • Targeting strategy development:

    • Design guide RNAs targeting conserved regions of the ND3 gene

    • Create both knockout and specific point mutations to study structure-function relationships

    • Target regulatory regions to study expression control

  • Transformation optimization:

    • Adapt protocols for efficient delivery to radish tissues

    • Optimize regeneration procedures for edited plants

    • Develop screening methods for identifying successful edits

  • Phenotypic characterization approaches:

    • Measure respiratory parameters in edited plants

    • Assess growth and development under various conditions

    • Quantify stress tolerance and metabolic adaptations

  • Genetic compensation analysis:

    • Identify potential compensatory mechanisms activated upon ND3 modification

    • Study alternative respiratory pathways that may become upregulated

    • Investigate retrograde signaling from mitochondria to nucleus

This research direction would provide valuable functional insights through precise genetic manipulation, particularly relevant given recent advances in understanding the radish genome .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.