Recombinant Raphanus sativus Uncharacterized mitochondrial protein ORF138

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Raphanus sativus Uncharacterized Mitochondrial Protein ORF138

Raphanus sativus Uncharacterized Mitochondrial Protein ORF138, also referred to as Orf138, is a protein associated with cytoplasmic male sterility (CMS) in radish plants . Specifically, Orf138 is linked to the Ogura CMS, a trait originally found in radish (Raphanus sativus) and later transferred to rapeseed (Brassica napus) . The orf138 gene is located in the mitochondrial DNA of plants with the Ogura cytoplasm, which causes male sterility .

Role in Cytoplasmic Male Sterility

Ogura CMS is caused by the orf138 gene, which disrupts the production of functional pollen, leading to male sterility without affecting female fertility . The protein product of orf138 accumulates in the inner membrane of mitochondria and is presumed to exert toxicity toward mitochondrial activity in the tapetum of anthers .

Fertility Restoration

The nuclear gene Rfo restores male fertility by altering the expression of Orf138 at the post-transcriptional level . Rfo encodes a pentatricopeptide repeat (PPR) protein . One such protein, named PPR-B, associates in vivo with the orf138 mRNA, leading to a significant reduction in Orf138 protein levels, particularly in tapetal cells and developing pollen grains . The Rfo-PPR protein (PPR-B) impacts the translation of orf138 mRNA by blocking ribosome progression along the orf138 coding sequence .

Expression and Regulation

  • Organ-Specific Reduction Nuclear restoration reduces the amount of Orf138 protein in mitochondria of flowers and leaves but not roots of fertile Ogura radish plants .

  • Post-Transcriptional Control Fertility restoration genes do not affect the size, abundance, or RNA editing patterns of orf138 transcripts, suggesting that restorer genes may influence the translation or stability of ORF138 .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is requested in advance (additional charges apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please specify this in your order; we will prioritize your request.
Synonyms
Uncharacterized mitochondrial protein ORF138
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Raphanus sativus (Radish)
Target Protein Sequence
MITFFEKLSTFCHNLTPTECKVSVISFFLLAFLLMAHIWLSWFSNNQHCLRTMRHLEKLK IPYEFQYGWLGVKITIKSNVPNDEVTKKVSPIIKGEIEGKEEKKEGKGEIEGKEEKKEGK GEIEGKEEKKEVENGPRK
Uniprot No.

Target Background

Function
This protein is involved in cytoplasmic male sterility (CMS) by inducing pollen abortion. It is not expressed in fertile plants.
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in roots, leaves and flowers.

Q&A

What is ORF138 and what is its role in plant reproduction?

ORF138 is a 138-amino acid mitochondrial protein encoded by the mitochondrial gene orf138 in Raphanus sativus (radish). It plays a critical role in Ogura cytoplasmic male sterility (CMS), preventing the production of functional pollen without affecting female fertility . The protein is approximately 20 kDa and associates with the inner membrane of mitochondria, likely assembled as a homopolymer . While not a chimeric polypeptide (unlike many other sterility-inducing proteins), ORF138 is presumed to produce a certain level of toxicity toward mitochondrial activity, particularly in the tapetum of anthers .

How does Ogura CMS differ from other CMS systems in plants?

Ogura CMS represents a distinct CMS system with several unique characteristics. Unlike many CMS systems where restoration involves altering CMS transcript levels, the Ogura restorer (Rfo) is exceptional because it does not affect the size or abundance of its cognate CMS-conferring mRNA . Instead, restoration occurs through translational control mechanisms. Ogura CMS has gained significant attention in breeding programs due to its complete pollen abortion, ease of transfer across species, and progeny sterility rate reaching 100%, making it widely used in cruciferous crop breeding .

What genetic variations exist in orf138 and how do they affect fertility restoration?

Sequence analyses of orf138 in wild and cultivated radishes have revealed nine haplotypes (Type A-I) based on six nucleotide substitutions and one insertion/deletion in the coding region . The Type B haplotype is considered ancestral, with other types derived from it. Notably, restoration effectiveness is highly dependent on specific nucleotide variations:

  • Type H orf138 is not affected by the Rfo gene but can be restored by Rfs

  • Type A can be restored by Rfo but not by Rfs

  • Type B (ancestral) can be suppressed by both Rfo and Rfs

The specificity of restoration is linked to single nucleotide substitutions that alter the binding site of the restorer protein. For example, a key nucleotide substitution at position 61 from the AUG start codon of orf138 can determine whether Rfo effectively restores fertility .

How does the Rfo fertility restorer gene suppress ORF138 expression?

Rfo (PPR-B) encodes a pentatricopeptide repeat (PPR) protein that binds specifically to the orf138 mRNA but, unlike many other restorer genes, does not promote the processing or degradation of the CMS transcript . The current model suggests that:

  • PPR-B binds directly to a specific site on the orf138 mRNA, approximately 55 nucleotides downstream of the AUG start codon

  • This binding impedes ribosome progression along the transcript, effectively blocking translation elongation

  • The specificity of binding is determined by a one-PPR-motif–one-nucleotide recognition rule, where amino acids at positions 5 and 35 of each PPR repeat are major determinants for RNA base selection

The restoration is tissue-specific, with PPR-B specifically affecting orf138 expression in the tapetum of anthers, which is critical for pollen development .

What other fertility restorer genes for Ogura CMS have been identified besides Rfo?

Multiple fertility restorer genes for Ogura CMS have been identified across different radish populations:

Restorer GeneSourceKey Characteristics
Rfo (PPR-B, Rfk)European radishMain restorer gene, blocks translation
RfobClosely linked with RfoHas two SNPs compared to Rfo
RfocGenerated by recombinationRecombination between Rfo (PPR-B) and PPR-C
RftTomioka population of Japanese wild radishHomolog of Rfo with 19 SNPs
Rfs-Cleaves orf138 mRNA of Type H
RsRf3-1/RsRf3-2Chinese radish materials (2007H)Recently cloned
RsRf3-4~RsRf3-7Chinese radish materials (9802H and 9606H)Recently cloned

Each of these restorer genes may utilize slightly different mechanisms to suppress ORF138 expression .

How can researchers effectively produce recombinant ORF138 protein for in vitro studies?

Production of recombinant ORF138 presents unique challenges due to its potential toxicity. Based on available research protocols:

  • Expression system selection: E. coli has been successfully used as an expression host , though the protein's expression reportedly inhibits bacterial growth , suggesting careful optimization of induction conditions is necessary.

  • Fusion strategy: The use of an N-terminal His tag facilitates purification and detection . For immunological studies, fusion with glutathione S-transferase has been effective for antibody production .

  • Purification: Standard methods for membrane protein purification with adjustments to account for ORF138's hydrophobic properties are recommended.

  • Storage: Store as lyophilized powder and avoid repeated freeze-thaw cycles. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C .

What are the most effective methods to detect and quantify ORF138 protein in plant tissues?

Several complementary approaches have proven effective:

  • Immunoblot analysis: Using antibodies raised against ORF138-glutathione S-transferase fusion protein has successfully detected a 20 kDa protein associated with mitochondrial membranes in sterile Ogura radish plants . This is particularly useful for comparative studies of fertile versus sterile lines.

  • In organello translation: Mitochondria isolated from both sterile and restored plants can be used for in vitro protein synthesis using labeled methionine, allowing detection of newly synthesized ORF138 .

  • Tissue-specific analysis: Analysis of different tissues (flowers, leaves, roots) is crucial as nuclear restoration has shown to dramatically reduce ORF138 in mitochondria of flowers and leaves, but not roots of fertile Ogura radish plants .

  • Immunolocalization: Has been successfully used to track the elimination of ORF138 from specific tissues, particularly the tapetum of anthers, which correlates with fertility restoration .

How can researchers study the interaction between ORF138 and fertility restorer proteins?

Several experimental approaches have proven valuable:

  • Co-immunoprecipitation: This approach has successfully demonstrated the in vivo association between PPR-B and orf138 mRNA, linking restoration activity with RNA-binding ability .

  • RNA gel shift assays: Using recombinant PPR-B fused to maltose binding protein and in vitro transcribed probes mapping to different regions of orf138 mRNA can identify specific binding sites .

  • Polysome sedimentation analysis: This approach effectively evaluates the translation status of orf138 transcript in both sterile and restored plants, demonstrating the negative impact of PPR-B on ribosome association with orf138 .

  • Ribo-Seq analysis: This has been employed to compare the translational status of all mitochondria-encoded mRNAs in CMS and fertility-restored lines, revealing a roughly 16-fold reduction in orf138 translation under PPR-B action .

How does tissue-specific expression of restorer genes affect ORF138 function and fertility restoration?

Research indicates a complex tissue-specific regulatory mechanism:

  • PPR-B protein accumulates preferentially in the anthers of young flower buds, indicating tissue-specific expression of the restorer gene .

  • Complete elimination of ORF138 from the tapetum of anthers correlates with fertility restoration, suggesting this specific tissue is crucial for the sterility phenotype .

  • The antagonistic effect of PPR-B on ORF138 synthesis appears stronger in anthers than in other floral tissues, with varying levels of suppression across different plant lines .

  • Even relatively low levels of PPR-B can lead to a dramatic decrease in ORF138 in specific tissues, indicating potential differences in regulatory mechanisms across tissue types .

This tissue specificity is critical for understanding the precise mechanism by which ORF138 prevents pollen development and how restoration operates in planta.

What is the molecular mechanism by which ORF138 causes male sterility?

While the precise molecular mechanism remains under investigation, current data suggest:

  • ORF138 resides in the inner membrane of mitochondria, likely assembled as a homopolymer .

  • The protein is presumed to produce toxicity toward mitochondrial activity specifically in the tapetum of anthers, as expression of orf138 strongly inhibits bacterial growth in experimental models .

  • The role of ORF138 appears distinct from many other CMS-causing proteins, as it is not a chimeric polypeptide composed of fragments of conventional mitochondrial proteins .

  • The sterility phenotype correlates with high levels of ORF138 protein rather than alterations in mitochondrial RNA editing or transcript processing, suggesting a direct effect of the protein on mitochondrial function .

Further research using mitochondrial activity assays and tissue-specific metabolomics could help elucidate the precise biochemical pathway disrupted by ORF138.

How do the 3' regions of different orf138 configurations affect mRNA stability and ORF138 expression?

Research on different configurations of orf138 reveals a critical role for 3' regions in post-transcriptional regulation:

Three configurations of orf138 have been studied: Nco2.5/13S (sterile), Nco2.7/13F (fertile), and Bam4.8/18S (sterile). These have identical 5' regions but different 3' regions. Key findings include:

  • The orf138 transcript from Bam4.8/18S is 10-fold more abundant than the one from Nco2.5/13S, while no orf138 transcript from Nco2.7/13F accumulates .

  • Transcriptional activity measurements show the rate of transcription is equivalent for all three configurations, strongly suggesting post-transcriptional regulation of mRNA levels .

  • In vitro decay and processing studies demonstrate that synthetic RNAs corresponding to the 3' region of the Nco2.7/13F transcript are less stable than RNAs corresponding to the 3' regions of the Nco2.5/13S and Bam4.8/18S transcripts .

  • In vitro processing of synthetic RNAs occurs at sites corresponding to the 3' ends of the natural mRNAs from sterile configurations, suggesting differential processing as a regulatory mechanism .

This research highlights how 3' regions play a crucial role in determining post-transcriptional control of orf138 expression, independent of the action of nuclear restorer genes.

What molecular markers are available for tracking orf138 and fertility restorer genes in breeding programs?

Several molecular markers have been developed for practical breeding applications:

Gene/TargetMarkersApplication
orf138Primer A/B, CMSF/R, orf138-F/RDetection of CMS cytoplasm
RfoRfo-SNP1, RFLP-PCR2F/1R with Ssp1Fertility restorer genotyping
Various Rf genesC3, R3, R15, R5, AFLP190Mapping different restorer loci
Specific markersSTS-A14, STS-K17, OPA-14600, OPK-17440DNA fingerprinting of restorers

These markers facilitate efficient selection and tracking of both CMS cytoplasm and fertility restorer genes in breeding programs .

How do orf138 haplotype variations impact fertility restoration in different genetic backgrounds?

The interaction between orf138 haplotypes and restorer genes exhibits fascinating specificity:

These differential responses are attributed to specific nucleotide substitutions:

  • A single nucleotide substitution in a 17-nucleotide region in orf138 mRNA (to which ORF687/Rfo binds) determines whether Rfo is effective .

  • Similarly, a single nucleotide change in the Rfs binding site makes it ineffective for Type A .

This specificity highlights the precise nature of RNA-protein interactions in fertility restoration systems and emphasizes the importance of genotyping both orf138 and restorer genes in breeding programs.

How do experimental approaches for studying ORF138 vary between model systems and crop species?

Research methodologies show important adaptations across different plant systems:

  • Radish (native system): Direct analysis of fertility phenotypes, protein expression, and genetic mapping using native genetic diversity. Nine haplotypes of orf138 provide natural variation for understanding structure-function relationships .

  • Rapeseed (transfer host): Transgenic approaches expressing PPR-A and PPR-B separately have been valuable for dissecting their functions . Polysome analysis and immunolocalization have been particularly informative in this system .

  • Arabidopsis (model system): Microsynteny analysis between Arabidopsis and radish has facilitated positional cloning of the Rfo locus . Knowledge of the extensive PPR protein family in Arabidopsis (more than 450 members) provides context for understanding Rfo function .

  • In vitro/bacterial systems: Expression of orf138 in bacteria has demonstrated its toxicity and provided a system for producing recombinant protein for biochemical studies .

These complementary approaches have collectively advanced our understanding of the ORF138-Rfo system, with each experimental platform offering unique advantages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.