Recombinant Raphus cucullatus Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Raphus cucullatus Cytochrome b

Recombinant Raphus cucullatus Cytochrome b (MT-CYB) is a laboratory-synthesized version of the Cytochrome b protein that was originally encoded by the mitochondrial genome of the Dodo bird. Cytochrome b is a critical component of the electron transport chain in cellular respiration, functioning within Complex III (also known as the Cytochrome bc1 complex) of the mitochondrial respiratory chain . The recombinant form of this protein has been developed to enable scientific examination of a protein from an extinct species, allowing for comparative studies with extant avian species and providing insights into evolutionary relationships.

The production of this recombinant protein involves expressing the gene sequence in a bacterial host system, specifically Escherichia coli, resulting in the synthesis of the Cytochrome b protein that would have been present in the mitochondria of the Dodo . This achievement represents a significant advancement in paleoproteomics, the study of ancient proteins, and offers valuable opportunities for investigating the biochemical and structural properties of proteins from extinct organisms.

Cytochrome b in Biological Systems

Cytochrome b proteins are integral membrane proteins found in the inner mitochondrial membrane of eukaryotes. These proteins play essential roles in cellular respiration by facilitating electron transfer during oxidative phosphorylation. In living organisms, mutations in the MTCYB gene have been associated with various pathological conditions, including mitochondrial myopathy, exercise intolerance, and multisystem disorders . Understanding the structure and function of Cytochrome b from various species, including extinct ones like the Dodo, can provide valuable comparative data for evolutionary biology and medical research.

Significance of Dodo-Derived Recombinant Proteins

The Dodo (Raphus cucullatus) was a flightless bird endemic to Mauritius that became extinct in the late 17th century due to human activities. The successful recombinant production of its Cytochrome b protein provides a unique opportunity to study a protein from an organism that no longer exists, offering insights into avian evolution and adaptation. This work represents an important bridge between paleogenomics and modern molecular biology, allowing researchers to examine the molecular characteristics of extinct species using contemporary laboratory techniques.

Production and Expression Systems

The Recombinant Raphus cucullatus Cytochrome b is produced using an in vitro E. coli expression system, a common approach for recombinant protein production . The protein is expressed with an N-terminal 10xHis-tag, which facilitates purification and detection of the recombinant protein .

Expression Optimization

Studies on other cytochrome proteins have shown that supplementation with 5-aminolevulinic acid can stimulate heme biosynthesis and increase protein yields . This approach might also be applicable to the production of Recombinant Raphus cucullatus Cytochrome b, potentially enhancing the incorporation of heme groups essential for the protein's native structure and function.

Research Applications

Recombinant Raphus cucullatus Cytochrome b offers several potential applications in scientific research:

  1. Comparative evolutionary studies with cytochrome b from extant bird species to understand avian evolution and phylogenetic relationships

  2. Structural biology research to examine the conservation of cytochrome b structure across evolutionary time

  3. Paleoproteomics investigations to develop methodologies for studying proteins from extinct species

  4. Antibody development for detection and isolation of related proteins in comparative studies

Limitations and Considerations

When working with Recombinant Raphus cucullatus Cytochrome b, researchers should consider several important factors:

  1. The recombinant protein is produced in a bacterial expression system, which may result in differences from the native protein in terms of post-translational modifications

  2. The addition of the His-tag, while necessary for purification, may influence protein folding or activity

  3. The reconstitution of proper heme incorporation is essential for functional studies, as cytochrome b proteins typically require heme groups for electron transfer activities

Cytochrome b in Mitochondrial Function and Evolution

Cytochrome b is encoded by the mitochondrial DNA gene MTCYB and serves as a critical component of the mitochondrial respiratory chain. In living organisms, this protein functions within Complex III to catalyze the transfer of electrons from ubiquinol to cytochrome c, contributing to the generation of ATP through oxidative phosphorylation .

Evolutionary Significance

The mitochondrial cytochrome b gene has been widely used in molecular phylogenetics and population genetics studies due to its relatively slow evolutionary rate compared to other mitochondrial genes . Analysis of cytochrome b sequences from different species has provided valuable insights into evolutionary relationships and genetic diversity. The availability of Recombinant Raphus cucullatus Cytochrome b enables direct comparison with cytochrome b proteins from extant avian species, potentially revealing evolutionary adaptations specific to the Dodo or its taxonomic group.

Pathological Implications in Living Species

While not directly applicable to the extinct Dodo, studies in living organisms have demonstrated that mutations in the MTCYB gene can lead to various pathological conditions. These include isolated mitochondrial myopathy, exercise intolerance, and more complex disorders such as mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS) . Understanding the structure and function of cytochrome b across different species, including extinct ones, may contribute to our understanding of these conditions in humans and other organisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer's requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Raphus cucullatus (Dodo)
Target Names
Target Protein Sequence
WWNFGSLLGICLMTQILTGLLLAAHYTADTTLAFSSVAHTCRDVQYGWLIRNLHANGASF FFICIYLHIGRGLYYGSYLYKETWNTGVILLLTLMATAFVGYVLPWGQMSFWGATVITNL FSAIPYIGQTIVEWAWGGFSVDNPTLTRFFTLHFLLPFMIAGLTIIHLTFLHESGSNNPL GISSNCDKIPFHPYFSLKDILGFTLMFLPLMTLALFAPNLLGDPENFTPANPLVTPPHIK PEWYFLFAYAILRSIPNKLGGVLALAA
Uniprot No.

Target Background

Function
Recombinant *Raphus cucullatus* Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane, which is essential for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Raphus cucullatus Cytochrome b (MT-CYB)?

Recombinant Raphus cucullatus Cytochrome b (MT-CYB) is a laboratory-synthesized protein that replicates the Cytochrome b protein from the extinct Dodo bird (Raphus cucullatus). The protein is a component of the mitochondrial respiratory chain, specifically identified as Complex III subunit 3, also known as Ubiquinol-cytochrome-c reductase complex cytochrome b subunit . The gene for this protein is located in the mitochondrial genome and is designated as MT-CYB, with synonyms including COB, CYTB, and MTCYB . Cytochrome b proteins are transmembrane hemoproteins that play crucial roles in electron transport chains and are highly conserved across species, making them valuable for evolutionary and comparative studies.

Why is studying the Cytochrome b of an extinct species like the Dodo scientifically valuable?

Studying the Cytochrome b of the extinct Dodo provides unique insights into evolutionary biology and phylogenetics. The Dodo (Raphus cucullatus) went extinct in the 17th century, with the last reported individuals observed on an offshore islet near Mauritius in 1662 . By analyzing and comparing the Cytochrome b sequence of this extinct bird with extant species, researchers can reconstruct evolutionary relationships, understand molecular evolution rates, and potentially gain insights into the genetic factors that might have contributed to the species' vulnerability to extinction. The MT-CYB gene is particularly valuable for these studies as it is well-conserved across species but contains sufficient variability to be informative for phylogenetic analyses.

What expression systems can be used to produce Recombinant Raphus cucullatus Cytochrome b?

While the search results don't specifically describe expression systems for Raphus cucullatus Cytochrome b, lessons can be drawn from successful expression systems for other cytochrome b proteins. For transmembrane hemoproteins like cytochrome b, several expression systems can be considered:

  • E. coli Rosetta-gami B(DE3) system: This system has been successfully used for other cytochrome b proteins, offering high yields (approximately 26 mg of purified, functional cytochrome per liter of culture) . The Rosetta-gami strain addresses problems with codon bias, disulfide bond formation, and target plasmid stability, which are critical for expressing complex proteins like cytochrome b.

  • Low-temperature induction: Expression at lower temperatures (around 20°C) after induction, supplemented with heme and δ-aminolevulinic acid, has proven effective for cytochrome b proteins .

Researchers should consider codon optimization for the expression host when designing the synthetic gene, as this can significantly improve expression levels, particularly when expressing ancient or extinct species' proteins in modern expression systems.

What purification methods are most effective for Recombinant Raphus cucullatus Cytochrome b?

Based on successful approaches with similar cytochrome b proteins, the following purification method would likely be effective for Recombinant Raphus cucullatus Cytochrome b:

  • Membrane fraction isolation: Centrifugation of cell lysate at high speed (approximately 100,000g) to isolate the membrane fraction containing the transmembrane cytochrome b protein .

  • Detergent solubilization: Extraction of the protein from membranes using n-dodecyl-β-D-maltoside (DM), typically at a concentration of 2% (w/v) in an appropriate buffer (such as 0.1 M potassium phosphate, pH 7.5, containing 5% glycerol) .

  • Affinity chromatography: Purification using cobalt ion affinity resin (TALON resin) for His-tagged recombinant protein, which has been shown to yield electrophoretically homogeneous cytochrome b proteins .

This combination of techniques can potentially achieve a purification yield of approximately 74% of the initial cytochrome content with a 76-fold increase in specific content, as demonstrated with similar cytochrome b proteins .

How can researchers assess the functional integrity of purified Recombinant Raphus cucullatus Cytochrome b?

The functional integrity of purified Recombinant Raphus cucullatus Cytochrome b can be assessed through several analytical methods:

  • Spectroscopic analysis: Reduced versus oxidized difference spectrum can determine the cytochrome content and functional integrity. Functional cytochrome b should show characteristic absorption peaks in the reduced state .

  • Heme to protein ratio: A properly folded cytochrome b should have a heme to protein ratio close to the theoretical value. For cytochrome b proteins with two heme centers, this would be approaching 2 .

  • Ascorbate reduction kinetics: Functional cytochrome b proteins often show ascorbate reducibility. Kinetic measurements can assess the reactivity with ascorbate, which is indicative of proper folding and heme incorporation .

  • SDS-PAGE analysis: Electrophoretic analysis can confirm the size and purity of the recombinant protein. For Raphus cucullatus Cytochrome b with a C-terminal His-tag, the expected molecular weight would be approximately 32 kDa .

Researchers should be cautious about protein oligomerization during analysis, as cytochrome b proteins have been observed to form oligomers when heated in SDS-PAGE sample buffer .

How can Recombinant Raphus cucullatus Cytochrome b be used in evolutionary studies?

Recombinant Raphus cucullatus Cytochrome b offers several valuable applications in evolutionary studies:

  • Phylogenetic reconstruction: By comparing the Cytochrome b sequence of the Dodo with that of extant bird species, researchers can reconstruct the evolutionary relationships of the Dodo within the Columbidae family (pigeons and doves) .

  • Molecular clock analyses: The known extinction time of the Dodo (circa 1662) provides a calibration point for molecular clock analyses, helping to refine the timing of evolutionary events within bird lineages.

  • Selection pressure analysis: Comparing functional aspects of the recombinant Dodo Cytochrome b with those of related extant species can reveal evolutionary adaptations and selection pressures that acted on this lineage.

  • Ancient protein structure-function studies: The recombinant protein allows for structural and functional characterization of an extinct species' protein, providing insights into how protein function may have evolved over time.

These applications contribute to our understanding of avian evolution and the specific evolutionary history of the Dodo, which occupied a unique ecological niche on the island of Mauritius until its extinction.

What can Recombinant Raphus cucullatus Cytochrome b tell us about mitochondrial function in extinct species?

Recombinant Raphus cucullatus Cytochrome b provides a unique window into mitochondrial function in this extinct species:

  • Respiratory chain comparison: By characterizing the kinetic and spectroscopic properties of Dodo Cytochrome b, researchers can infer aspects of mitochondrial respiratory chain function in this extinct bird and compare it with extant relatives.

  • Metabolic adaptation insights: Differences in functional properties between Dodo Cytochrome b and that of extant species might reflect metabolic adaptations to the Dodo's island environment and ecology.

  • Extinction vulnerability factors: Analysis of potentially unique features in Dodo Cytochrome b could provide insights into metabolic factors that might have contributed to the species' vulnerability to extinction following human colonization of Mauritius.

  • Historical environmental adaptation: The functional characteristics of Dodo Cytochrome b might reflect adaptations to the historical environmental conditions of Mauritius prior to human colonization.

These studies can contribute to our understanding of how mitochondrial function evolves in response to ecological factors and potentially inform conservation efforts for extant island bird species.

What structural differences might exist between Raphus cucullatus Cytochrome b and that of extant bird species?

Advanced structural analysis of Recombinant Raphus cucullatus Cytochrome b might reveal several types of differences compared to extant bird species:

  • Amino acid substitutions in functional domains: Specific substitutions in the heme-binding regions, transmembrane domains, or substrate interaction sites might affect electron transfer efficiency or substrate specificity.

  • Altered post-translational modifications: Differences in potential phosphorylation, glycosylation, or other modification sites could impact protein function or regulation.

  • Structural stability variations: Amino acid changes might affect the thermal stability or pH sensitivity of the protein, potentially reflecting adaptation to the subtropical island environment of Mauritius.

  • Interaction surface modifications: Changes in the surfaces that interact with other components of the respiratory chain could affect the efficiency of electron transfer or the assembly of respiratory complexes.

Researchers should employ computational modeling approaches before experimental structural studies to predict potential structural differences and their functional implications, which can guide subsequent experimental designs.

How can researchers design experiments to compare the functional properties of Dodo Cytochrome b with those of extant species?

To effectively compare the functional properties of Recombinant Raphus cucullatus Cytochrome b with those of extant species, researchers should consider the following experimental design approach:

  • Parallel expression and purification: Express and purify cytochrome b proteins from the Dodo and selected extant species using identical expression systems and purification protocols to minimize method-induced variations.

  • Spectroscopic characterization:

    • Compare absorption spectra in both reduced and oxidized states

    • Analyze redox potentials of the heme centers

    • Measure kinetics of reduction by ascorbate and other physiological reductants

  • Reconstitution studies:

    • Incorporate the purified proteins into liposomes or nanodiscs

    • Measure electron transfer rates within reconstituted systems

    • Assess interaction with other components of the respiratory chain

  • Stability assessments:

    • Compare thermal stability using differential scanning calorimetry

    • Evaluate pH-dependent stability profiles

    • Assess resistance to denaturants

  • Structural studies:

    • Compare secondary structure content using circular dichroism

    • If possible, determine high-resolution structures using X-ray crystallography or cryo-EM

    • Analyze membrane topology using limited proteolysis

These comparative analyses should be conducted under identical conditions with appropriate technical replicates and statistical analysis to identify significant functional differences.

What specific technical challenges might researchers encounter when working with Recombinant Raphus cucullatus Cytochrome b?

Researchers working with Recombinant Raphus cucullatus Cytochrome b may encounter several technical challenges:

  • Codon optimization issues: Since the original DNA sequence comes from an extinct species, optimal codon usage for expression hosts might be difficult to determine without extensive optimization studies.

  • Protein solubility and stability: Transmembrane proteins like cytochrome b are notoriously difficult to maintain in a soluble, stable form. Researchers may need to screen multiple detergents beyond the standard n-dodecyl-β-D-maltoside to identify optimal solubilization conditions .

  • Oligomerization tendencies: Cytochrome b proteins have been observed to form oligomers, particularly when heated during sample preparation for SDS-PAGE . This tendency may complicate structural and functional studies.

  • Proper heme incorporation: Ensuring proper incorporation of the correct heme prosthetic groups in the recombinant protein might require optimization of expression conditions, including supplementation with heme precursors.

  • Functional reconstitution: For functional studies, reconstituting the protein into membranes or membrane-mimetic systems while maintaining native-like activity presents significant challenges.

To address these challenges, researchers should consider preliminary small-scale expression and purification trials, testing multiple detergents and buffer conditions before scaling up production.

How should researchers interpret differences in sequence and function between Dodo Cytochrome b and that of extant species?

When interpreting differences in sequence and function between Raphus cucullatus Cytochrome b and that of extant species, researchers should consider the following analytical framework:

  • Distinguishing neutral from adaptive changes: Not all sequence differences will have functional significance. Computational approaches such as dN/dS ratio analysis can help identify positions under positive selection versus neutral drift.

  • Ecological context consideration: Interpret functional differences in light of the known ecology of the Dodo on Mauritius, considering factors such as diet, metabolism, and environmental conditions that might have driven adaptive changes.

  • Phylogenetic correction: When comparing functional properties, researchers should employ phylogenetic comparative methods to account for shared evolutionary history rather than treating species as independent data points.

  • Functional significance thresholds: Establish reasonable thresholds for what constitutes a biologically significant functional difference versus experimental variation.

  • Convergence consideration: Assess whether any unique features of Dodo Cytochrome b might represent convergent evolution with distantly related species that occupied similar ecological niches.

This interpretative approach will help avoid overstatement of the significance of minor differences while highlighting truly important adaptations that might have characterized this extinct species.

What can purification yield and quality data tell us about the production of Recombinant Raphus cucullatus Cytochrome b?

A detailed analysis of purification yield and quality data can provide valuable insights about the production process of Recombinant Raphus cucullatus Cytochrome b. Based on comparable cytochrome b purification data, researchers might expect results similar to the following table:

Purification StepTotal Protein (mg)Cytochrome b (nmol)Specific Content (nmol/mg)Yield (%)Purification (fold)
Cell lysate~5500~2200~0.401001
Detergent extract~1500~2000~1.33~94~3.3
Affinity chromatography~50~1600~30.2~74~76

This type of data would indicate :

  • Expression efficiency: The initial yield in cell lysate reflects how well the expression system is producing the recombinant protein.

  • Extraction efficiency: The high recovery in the detergent extract step (~94%) would suggest effective solubilization of the membrane-bound protein.

  • Purification effectiveness: A 76-fold purification with 74% yield through affinity chromatography would represent an efficient purification process.

  • Protein quality: The specific content of the final product (nmol of cytochrome per mg of total protein) indicates the purity and proper folding of the recombinant protein.

Deviations from these expected values would prompt investigation of expression conditions, detergent selection, or chromatography parameters to optimize the production process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.