Recombinant Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (Agpat4)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Rat 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (Agpat4) is a genetically engineered enzyme critical for phospholipid biosynthesis. Agpat4 catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA), the second step in the Kennedy pathway of glycerolipid synthesis . This enzyme localizes to mitochondria and regulates lipid metabolism, membrane biogenesis, and signaling pathways .

Production and Biochemical Characteristics

Recombinant Agpat4 is produced in heterologous systems such as E. coli, yeast, or mammalian cells . Key specifications include:

ParameterDetails
Host SystemE. coli, Yeast, Baculovirus, or Mammalian Cells
Purity≥85% (SDS-PAGE)
Amino Acid SequenceFull-length (1-378 residues) with N-terminal His tag
Molecular Weight~45 kDa (predicted)
StorageLyophilized in Tris/PBS buffer (pH 8.0) with 6% trehalose; -80°C

Key Features:

  • Retains enzymatic activity comparable to native Agpat4 .

  • Compatible with assays requiring high specificity (e.g., ELISA, Western blot) .

Enzymatic Activity and Substrate Specificity

  • Catalytic Function: Agpat4 exhibits robust acyltransferase activity, favoring saturated and monounsaturated acyl-CoA substrates (e.g., C12:0, C16:0) .

  • Subcellular Localization: Predominantly mitochondrial, contributing to lipid remodeling in energy-demanding tissues .

Role in Disease Pathogenesis

  • Cancer: Agpat4 overexpression in colorectal cancer (CRC) reduces lysophosphatidic acid (LPA) levels, promoting tumor progression via immune evasion .

  • Metabolic Regulation: Agpat4 deficiency in mice increases triacylglycerol (TAG) content in epididymal adipose tissue, suggesting tissue-specific lipid metabolic roles .

Research Applications

Recombinant Agpat4 is widely used in:

  • Lipid Metabolism Studies: Elucidating pathways in phospholipid synthesis and remodeling .

  • Drug Discovery: Screening inhibitors targeting AGPAT isoforms for cancer therapy .

  • Diagnostic Tools: Development of species-specific ELISA kits (detection range: 1.0–250 ng/mL) .

Comparative Analysis Across Species

SpeciesDetection RangeSensitivityApplications
Rat5.0–100 ng/mL1.0 ng/mLELISA, Western blot, RNA interference
Bovine10–250 ng/mL1.0 ng/mLLipidomics, enzyme kinetics
HumanN/AN/AImmunohistochemistry, cancer studies

Key Research Findings

  • Structural Insights: The recombinant protein retains functional domains critical for acyltransferase activity, including conserved motifs for substrate binding .

  • Therapeutic Potential: Silencing Agpat4 in CRC models suppresses tumor growth by reactivating antitumor immunity via LPA-mediated macrophage polarization .

  • Regulatory Mechanisms: Agpat4 expression is modulated during embryogenesis and metabolic stress, linking it to developmental and adaptive processes .

Challenges and Future Directions

  • Functional Heterogeneity: Tissue-specific roles of Agpat4 require further elucidation .

  • Therapeutic Targeting: Developing isoform-specific inhibitors remains challenging due to structural conservation among AGPAT family members .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Agpat4; 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 4; 1-AGP acyltransferase 4; 1-AGPAT 4; Lysophosphatidic acid acyltransferase delta; LPAAT-delta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MDLIGLLKSQFLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQ LVMLLEWWSGTECTIYTDPKASPHYGKENAIVVLNHKFEIDFLCGWSLAERLGILGNSKV LAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLRDYPEKYLFLIHCEGTRF TEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVVPAVYDCTLNFRNNENPTL LGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLHKLYQEKDAFQEEYYRTGVFPETPWV PPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLASLVLIFCMASMGVRWMIGVTE IDKGSAYGNIDNKRKQTD
Uniprot No.

Target Background

Function
This enzyme converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. It exhibits high acyl-CoA specificity for polyunsaturated fatty acyl-CoA, particularly docosahexaenoyl-CoA (22:6-CoA, DHA-CoA).
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary catalytic function of Agpat4?

Agpat4 functions as a true acylglycerophosphate acyltransferase (AGPAT)/lysophosphatidic acid acyltransferase (LPAAT) that catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA). Studies have confirmed that Agpat4 specifically utilizes LPA as its major lysophospholipid acyl-acceptor in the acylation reaction. PA produced through this pathway serves as a crucial precursor for triacylglycerol (TAG) and various phospholipid species, positioning Agpat4 as an important enzyme in the second step of de novo phospholipid biosynthesis .

How does Agpat4 expression vary across different tissues?

Agpat4 demonstrates a distinct tissue-specific expression profile compared to other AGPAT isoforms. While AGPATs 1 and 3 show ubiquitous expression patterns, Agpat4 exhibits more restricted tissue distribution. Notably, Agpat4 shows consistent expression across various white adipose tissue (WAT) depots. The differential expression patterns of AGPAT isoforms, including Agpat4, suggest distinct physiological roles in different tissues, although the full significance of these distribution patterns remains incompletely understood .

Does Agpat4 contribute to specific phospholipid pools?

Yes, Agpat4 appears to support the production of specific phospholipid species in a tissue-dependent manner. In mouse brain, Agpat4-derived PA forms a functionally distinct substrate pool specifically supporting the synthesis of phosphatidylinositol (PI), phosphatidylcholine (PC), and phosphatidylethanolamine (PE). This finding suggests that PA does not form a single homogeneous pool within cells but is instead channeled by individual AGPAT/LPAAT homologs into specific substrate pools that support the production of different glycerolipids in various tissues .

What alternative nomenclature exists for Agpat4?

Agpat4 is known by several alternative names in the scientific literature, which can create confusion when conducting literature searches. Alternative designations include 1-AGPAT4, LPAAT-delta, and dJ473J16.2. These nomenclature variations reflect its classification within the broader 1-acylglycerol-3-phosphate O-acyltransferase family and its specific activity as a delta isoform of lysophosphatidic acid acyltransferase .

What techniques are recommended for confirming Agpat4 knockout in experimental models?

Effective confirmation of Agpat4 knockout requires multiple complementary approaches. Genotyping can be performed using PCR with primers specific to both the wild-type region (e.g., forward: 5′-TTA GCA TAG TGG GCG AAG TTC-3′, reverse: 5′-GGT AGT GGC CAA GTT AAT AGT CCT-3′ yielding a 216 bp product) and the recombined targeted region (forward: 5′-GCA GCG CAT CGC CTT CTA TC-3′, reverse: 5′-CTC CCA TTT CTA GGA AGG AAG CAG-3′ yielding a 344 bp product). Additionally, RT-PCR confirmation of transcript absence should employ primers spanning the excised exons, such as a forward primer in the excised fourth exon (5′-ATC ACG CTG ACT GCT ACG TTC GGA-3′) and a reverse primer in the excised sixth exon (5′-GAG TCT TCT GGG AAG ACC CCT GTC-3′) .

How should researchers analyze phenotypic changes in Agpat4-deficient models?

A comprehensive assessment of Agpat4 knockout phenotypes should include multiple physiological and biochemical parameters. For metabolic phenotyping, continuous monitoring systems (e.g., Comprehensive Laboratory Animal Monitoring System) should be employed to assess energy expenditure (heat, VO2), food intake, fuel substrate preference (RER, fat oxidation, carbohydrate oxidation), and activity levels. Tissue-specific analyses should include lipid profiling (TAG content and fatty acid composition), phospholipid composition analysis, histological assessment of cell size and morphology, and molecular analysis of compensatory gene expression changes. Importantly, researchers should analyze multiple tissue depots (e.g., both epididymal and perirenal WAT) to identify depot-specific effects that may be missed in single-depot studies .

What methodological approaches are effective for studying Agpat4 enzymatic activity?

When studying Agpat4 enzymatic activity, researchers should implement assays that specifically measure the conversion of LPA to PA. In vitro assays using purified recombinant Agpat4 protein or membrane fractions from Agpat4-expressing cells should include appropriate substrate concentrations and cofactors (typically Mg2+ or Mn2+). Reaction products can be analyzed by thin-layer chromatography, liquid chromatography-mass spectrometry, or radiometric assays using labeled substrates. Critical controls should include heat-inactivated enzyme preparations and competitive inhibitors of AGPAT activity. When interpreting results, researchers must consider the potential contributions of other AGPAT isoforms and compensatory mechanisms, particularly in complex biological samples .

What analytical techniques should be employed to assess changes in lipid profiles following Agpat4 manipulation?

Comprehensive lipid analysis following Agpat4 manipulation should employ techniques capable of distinguishing between various lipid classes and their fatty acid compositions. This should include quantification of:

  • Total TAG content with fatty acid class determination (saturated, MUFA, n-6 PUFA, n-3 PUFA)

  • Major phospholipid species content (PA, PC, PE, phosphatidylglycerol, PI, phosphatidylserine, cardiolipin)

  • Fatty acid composition within each lipid class

Mass spectrometry-based lipidomics approaches are particularly valuable for detailed molecular species analysis. Additionally, researchers should correlate lipid compositional changes with functional outcomes and gene expression changes in lipid metabolic pathways .

How does Agpat4 deficiency affect different adipose tissue depots?

Agpat4 deficiency exhibits remarkable depot-specific effects on white adipose tissue. Studies show that male Agpat4-/- mice display a 40% increase in epididymal WAT mass compared to wild-type littermates, while perirenal, retroperitoneal, and inguinal WAT depots, as well as subscapular brown adipose tissue, remain unchanged. The epididymal depot-specific effect manifests as doubled TAG content (primarily saturated fatty acids) and increased adipocyte size without alterations in differentiation markers. This is accompanied by a 74% increase in PA content specifically in epididymal WAT. These findings highlight the molecular and metabolic heterogeneity of individual visceral fat depots and suggest that Agpat4 plays a unique, non-redundant role specifically in epididymal WAT .

What compensatory mechanisms operate following Agpat4 ablation in different tissues?

Compensatory mechanisms following Agpat4 ablation are tissue-dependent and may explain the observed depot-specific effects. In perirenal WAT, Agpat4 deficiency triggers upregulation of alternate AGPAT isoforms (Agpats 1, 2, 3, and 5) and glycerol-3-phosphate acyltransferases (Gpats 1, 2, 3, and 4). This compensatory response appears sufficient to normalize PA levels and maintain normal lipid profiles and tissue function in this depot. In contrast, epididymal WAT lacks this compensatory upregulation, leading to altered PA levels and downstream functional consequences. This differential compensatory capacity across tissues appears to be a key determinant of the tissue-specific phenotypic effects observed in Agpat4-/- mice .

Why does Agpat4 deficiency lead to increased rather than decreased PA levels in some tissues?

Counterintuitively, Agpat4 deficiency leads to increased PA levels in epididymal WAT despite the enzyme's role in PA synthesis. This apparent paradox is not unprecedented; male Agpat2 null mice similarly display increased liver PA content. The mechanism likely involves complex metabolic adaptations, potentially including:

  • Reduction in PA utilization or turnover

  • Increased PA production through alternative pathways

  • Altered compartmentalization of PA pools within the cell

  • Compensatory activities of other lipid metabolic enzymes

The observation that PA does not form a single homogeneous pool within cells, but instead is channeled by individual AGPAT/LPAAT homologs into specific substrate pools, may partly explain this phenomenon. The tissue-specific nature of these effects further emphasizes the complex regulatory networks governing phospholipid metabolism .

How does Agpat4 influence lipid metabolic pathways in adipose tissue?

In epididymal WAT, Agpat4 deficiency appears to reduce lipid mobilization rather than increase synthesis. While total TAG hydrolase activity is reduced in Agpat4-/- mice, with significant decreases in adipose triglyceride lipase (ATGL) and reduced phosphorylation of hormone-sensitive lipase (HSL) at PKA-activation sites (S563 and S660), there are minimal changes in lipogenic enzyme expression. Analysis of enzymes involved in de novo lipogenesis (FAS, ACC, phosphorylated ACC, AMPKα) and complex lipid synthesis downstream of PA production shows no significant differences between genotypes. Only two lipid biosynthetic genes, Lpin1 and Dgat1, show increased expression (2.3-fold and 2.0-fold, respectively) in epididymal WAT from Agpat4-/- mice, though these changes do not translate to altered protein levels .

What controls are essential when studying recombinant Agpat4 in experimental systems?

When studying recombinant Agpat4, researchers should implement several critical controls:

  • Empty vector or mock-transfected controls to account for expression system effects

  • Wild-type protein controls for comparison with mutant or modified versions

  • Enzymatically inactive mutants (targeting catalytic residues) to distinguish between catalytic and non-catalytic functions

  • Other AGPAT family members to assess isoform specificity

  • Endogenous Agpat4 expression analysis in the experimental system to account for baseline activity

  • Verification of protein expression levels through immunoblotting or other quantitative methods

  • Subcellular localization confirmation to ensure proper protein targeting

How should researchers account for redundancy among AGPAT family members?

The functional redundancy among AGPAT family members presents significant challenges for researchers studying individual isoforms. To address this issue, experimental designs should:

  • Quantify expression of all AGPAT isoforms in the experimental system

  • Employ combinatorial knockdown or knockout approaches when single isoform manipulation yields minimal effects

  • Use isoform-specific inhibitors when available

  • Consider tissue-specific experimental designs based on known expression patterns of different isoforms

  • Analyze compensatory changes in other AGPAT isoforms following manipulation of the target isoform

  • Employ substrate specificity assays to distinguish between isoform functions

  • Consider subcellular compartmentalization of different isoforms

What experimental approaches can distinguish between different subcellular PA pools?

Distinguishing between functionally distinct PA pools requires specialized experimental approaches:

  • Subcellular fractionation combined with lipidomic analysis to physically separate different cellular compartments

  • Pulse-chase studies with labeled precursors to track the metabolic fate of PA synthesized by different pathways

  • Targeted manipulation of specific AGPAT isoforms known to localize to different subcellular compartments

  • Analysis of PA-binding proteins and their subcellular distribution

  • Imaging techniques using fluorescently-labeled PA-binding domains

  • Metabolic flux analysis to trace PA into different downstream pathways

  • Correlation of specific PA molecular species with functional outcomes

What considerations are important when designing expression systems for recombinant Agpat4?

When designing expression systems for recombinant Agpat4, researchers should consider:

  • Host cell selection based on endogenous lipid metabolism and AGPAT expression profiles

  • Membrane protein expression capabilities of the host system

  • Post-translational modification requirements

  • Expression tags (location and type) that minimize interference with enzymatic activity

  • Inducible versus constitutive expression strategies

  • Co-expression of interacting proteins or metabolic partners

  • Subcellular targeting sequences to ensure proper localization

  • Purification strategies compatible with membrane protein functionality

  • Storage conditions that preserve enzymatic activity

How might Agpat4 function differ across species?

Recombinant Agpat4 proteins have been produced from multiple species including human, rat, mouse, cynomolgus/rhesus macaque, feline, canine, bovine, and equine sources. While the core catalytic function is likely conserved, species-specific differences may exist in tissue distribution patterns, regulation, substrate preferences, and interaction partners. Comparative studies examining species-specific differences in Agpat4 function could provide valuable insights into evolutionary adaptations in phospholipid metabolism. Such studies should systematically compare enzymatic parameters, tissue expression patterns, and functional outcomes of genetic manipulation across multiple species .

What is the significance of Agpat4's role in creating distinct PA pools?

The evidence that Agpat4 generates functionally distinct PA pools that support the production of specific phospholipid species represents a paradigm shift in understanding phospholipid metabolism. This concept of "metabolic channeling" within lipid synthesis pathways suggests that seemingly redundant enzymes may actually serve unique functions by creating spatially or temporally distinct substrate pools. Future research should aim to:

  • Characterize the unique lipid composition of Agpat4-dependent PA pools

  • Identify proteins that specifically interact with Agpat4-derived PA

  • Determine the subcellular localization and trafficking of Agpat4-derived PA

  • Investigate whether Agpat4-dependent PA pools are differentially regulated in response to cellular stimuli

  • Explore the consequences of disrupting these specific pools in various physiological and pathological contexts

What molecular mechanisms explain the depot-specific effects of Agpat4 deficiency?

The striking depot-specific effects of Agpat4 deficiency on adipose tissue represent an intriguing scientific question. Future research should investigate:

  • Depot-specific differences in Agpat4 expression, localization, and activity

  • Differential expression of interacting proteins or regulatory factors across depots

  • Variations in lipid composition and metabolism between adipose depots

  • Depot-specific differences in compensatory mechanisms

  • Potential hormonal or signaling factors that influence Agpat4 function in a depot-specific manner

  • Developmental origins of depot-specific lipid metabolism

Understanding these mechanisms could provide broader insights into the molecular basis of adipose tissue heterogeneity and its implications for metabolic health and disease .

How does Agpat4 integrate into broader lipid metabolic networks?

While current research has focused on Agpat4's direct enzymatic function, its integration into broader lipid metabolic networks remains largely unexplored. Future studies should examine:

  • How Agpat4 activity is regulated in response to nutritional status, hormonal signals, and cellular stress

  • Cross-talk between Agpat4-dependent pathways and other lipid metabolic pathways

  • Potential non-catalytic functions of Agpat4 in signaling or protein-protein interactions

  • The role of Agpat4 in membrane homeostasis and remodeling

  • Integration of Agpat4 function with energy metabolism and mitochondrial function

Such studies would provide a more comprehensive understanding of Agpat4's physiological significance beyond its catalytic role in PA synthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.