Recombinant Rat 2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Ugt8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance to arrange dry ice shipping, as additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Ugt8; Cgt; Ugt4; 2-hydroxyacylsphingosine 1-beta-galactosyltransferase; Ceramide UDP-galactosyltransferase; CGalT; Cerebroside synthase; UDP-galactose-ceramide galactosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-541
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ugt8
Target Protein Sequence
AKIIIVPPIMFESHLYIFKTLASALHERGHHTVFLLSEGRDIDPSNHYSLQRYPGIFNST TSDAFLQSKMRNIFSGRLTAVELVDILDHYTKNCDMMVGNQALIQGLKKEKFDLLLVDPN DMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNFLERMKNTGVY LISRMGVSFLVLPKYERIMQKYNLLPAKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVY VGGILTKPASPLPEDLQRWVDGAQEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVI WRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLF GDHYDTMTRVQAKGMGILLEWNTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQPGHP VNRTTYWIDYILRHDGAHHLRSAVHQISFCQYFLLDIAFVLLLGAVALYFIVSYVTKFIY RKVKSLCSRSTHSTVNGHYQNGILNGRYKGNGHIKHEKKVK
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of galactose to ceramide, a crucial step in galactocerebroside biosynthesis. Galactocerebrosides are abundant sphingolipids found in the myelin membranes of the central and peripheral nervous systems. The enzyme galactosylates both hydroxy- and non-hydroxy fatty acid-containing ceramides and diglycerides.

Database Links

KEGG: rno:50555

STRING: 10116.ENSRNOP00000012676

UniGene: Rn.9744

Protein Families
UDP-glycosyltransferase family
Subcellular Location
Membrane; Single-pass membrane protein. Endoplasmic reticulum.
Tissue Specificity
Brain, restricted to the oligodendrocyte-containing cell layers of cerebrum and cerebellum.

Q&A

What is the basic structure and classification of Ugt8?

Ugt8 (UGT8A1) belongs to the UGT-glycosyltransferase (UGT) superfamily in mammals. The UGT superfamily is categorized into four groups: UGT1, UGT2, UGT3, and UGT8, with UGT8 containing only one member, UGT8A1. Similar to other UGT proteins, UGT8 has a UGT domain structure and signature sequence with a single transmembrane domain. The protein structure includes specific residues essential for its function, notably H358, which is critical for enzymatic activity . Unlike most UGT proteins which have aspartate and glutamine (DQ) motifs at the end of the UGT signature sequence, UGT8 features a DH motif where glutamine is replaced by histidine (H383), a substitution proposed to be important for galactose recognition .

What are the primary enzymatic functions of Ugt8?

Ugt8 functions primarily as a galactosyltransferase that catalyzes the transfer of galactose from UDP-galactose (its sugar donor) to various lipid substrates. Initially named ceramide galactosyltransferase (CGT), UGT8 was known for synthesizing galactosylceramide (GalCer), a major component of the myelin sheath constituting almost one-third of its lipid mass. Recent research has conclusively demonstrated that UGT8 also functions as a monogalactosyl diacylglycerol (MGDG) synthase in mammals . The enzyme shows preference for ether-linked DG (O-16:0_16:0) as a substrate for MGDG synthesis .

What is the subcellular localization of Ugt8 and how does it relate to its function?

Ugt8 is primarily localized to the endoplasmic reticulum (ER), which is consistent with its role in lipid metabolism and membrane homeostasis. This localization is significant because the disruption of membrane lipid homeostasis by the elevation of saturated fatty acids in the ER can cause ER stress. UGT8-derived MGDG appears to be involved in the activation of PERK (an ER stress sensor) under conditions of membrane lipid saturation, suggesting a role in cellular stress response pathways . Understanding this localization is crucial for designing experiments that accurately reflect the enzyme's native environment.

What are the validated methods for detecting and measuring Ugt8 expression?

Several complementary approaches can be employed to detect and measure Ugt8 expression:

Transcriptional analysis:

  • Semi-quantitative RT-PCR and quantitative RT-PCR (qPCR) have been successfully used to detect UGT8 mRNA levels in various cell types .

  • For qPCR, primers targeting conserved regions of the Ugt8 gene should be designed and validated against appropriate reference genes.

Protein detection:

  • Western blotting using specific anti-UGT8 antibodies is effective for protein quantification .

  • When using tagged constructs, C-terminal tagging appears more reliable than N-terminal tagging, as N-terminal tags may be cleaved. Research has shown that when N-terminal FLAG-tagged mouse Ugt8 (FLAG-mUgt8) was transiently overexpressed, it was not successfully detected using anti-FLAG antibodies, whereas C-terminal tagged mUgt8-FLAG was readily detected .

Activity assays:

  • Enzymatic activity can be measured using specific substrates and analyzing the galactosylated products via liquid chromatography-mass spectrometry (LC-MS) techniques .

What approaches are recommended for studying Ugt8 function through loss-of-function experiments?

Several validated approaches for loss-of-function studies include:

siRNA-mediated knockdown:

  • Multiple siRNAs targeting different regions of Ugt8 mRNA should be employed to ensure specificity.

  • Effective knockdown can be confirmed by Western blotting to verify protein reduction .

  • This approach has successfully demonstrated that UGT8 knockdown significantly decreases MGDG content in HeLa cells (by approximately 92.8% for MGDG and 80.7% for ether MGDG) .

CRISPR-Cas9 gene editing:

  • Complete knockout of Ugt8 can be achieved using CRISPR-Cas9 technology.

  • Verification should include sequencing of the targeted locus and confirmation of protein absence.

Chemical inhibition:

  • Zoledronic acid (ZA) has been identified as a potential inhibitor of UGT8 .

  • When using inhibitors, dose-response experiments should be conducted to determine optimal concentrations for inhibition without off-target effects.

What are the recommended methods for analyzing Ugt8-associated lipid products?

Analysis of Ugt8-associated lipid products requires sophisticated analytical techniques:

LC-QTOF-MS (Liquid Chromatography-Quadrupole Time-of-Flight Mass Spectrometry):

  • This technique has been successfully employed to analyze lipid profiles in UGT8-expressing cells .

  • The method allows for detection and quantification of both MGDG and galactosylceramide (GalCer).

Immunoblotting for specific lipids:

  • Anti-GalCer and anti-sulfatide antibodies can be used for detecting these lipids in cell extracts .

  • This approach is particularly useful for relative quantification across experimental conditions.

Immunostaining-confocal analysis:

  • This technique provides spatial information about lipid distribution within cells .

  • It complements biochemical analyses by revealing subcellular localization patterns.

How does Ugt8 contribute to membrane lipid homeostasis and cellular stress responses?

UGT8 plays a sophisticated role in membrane lipid homeostasis through several mechanisms:

Regulation of MGDG synthesis:
UGT8 is now recognized as the primary enzyme responsible for MGDG synthesis in mammals. Although MGDG constitutes less than 0.1% of the amount of phosphatidylcholine (PC), it is enriched in microsomal compartments and appears to play a disproportionately important role in membrane function .

Influence on ER stress pathways:
UGT8-derived MGDG is involved in the cellular response to membrane lipid saturation. Specifically, it appears to modulate the activation of the PERK pathway during ER stress. In UGT8 knockout cells, membrane lipid saturation-induced unfolded protein response (UPR) is suppressed, as evidenced by reduced PERK phosphorylation and downstream CHOP mRNA induction .

Interaction with stress sensors:
Since PERK uses its transmembrane domain to sense membrane lipid saturation, it's hypothesized that UGT8-derived MGDG may target this domain to activate UPR signals. This suggests a direct molecular mechanism by which UGT8 influences cellular stress response pathways .

What is known about the structure-function relationship of Ugt8's catalytic domain?

Key insights into the structure-function relationship of Ugt8's catalytic domain include:

Critical catalytic residues:

  • H358 has been identified as a critical residue for UGT8 activity. Mutation studies have shown that the H358A variant is unable to enhance MGDG or HexCer production, despite comparable expression levels to wild-type protein .

  • In contrast, the H383Q mutation (changing the DH motif to a DQ motif) does not significantly impair the enzyme's ability to increase MGDG and HexCer content, indicating that this residue is not critical for UDP-galactose recognition, contrary to previous hypotheses .

UDP-galactose binding:
Unlike other mammalian UGTs that use UDP-glucuronic acid (UGT1 and UGT2) or UDP-N-acetylglucosamine (UGT3) as substrates, UGT8 specifically utilizes UDP-galactose as its sugar donor . The molecular basis for this substrate specificity remains an active area of investigation.

What experimental strategies can be employed to study the role of Ugt8 in disease models?

Various experimental approaches have been utilized to investigate Ugt8's role in disease:

Genetic models:

  • UGT8-knockout mice have confirmed that UGT8 is the only enzyme for GalCer synthesis in the brain and is involved in myelin function and stability .

  • The LEW/Jms rat strain, which has inherited hydrocephalus, has been used in studies to identify genetic loci associated with the condition, which may relate to UGT8 function .

Cell line models:

  • Stable transfectants with empty vector or knockdown of UGT8 expression in cancer cell lines (such as MDA-MB231 and SUM159) and stable clones with empty vector or UGT8 expression in other cell lines (BT549 and HCC1937) have been created to study UGT8's role in cancer progression .

Disease-specific analyses:

  • In basal-like breast cancer (BLBC), UGT8 has been found to be dramatically up-regulated and associated with poor prognosis .

  • UGT8 expression provides tumorigenic and metastatic advantages in BLBC through activating the sulfatide–αVβ5 axis, suggesting a mechanism by which UGT8 contributes to cancer aggressiveness .

What are the key considerations when designing recombinant Ugt8 expression systems?

When designing recombinant Ugt8 expression systems, researchers should consider:

Tagging strategy:

  • C-terminal tagging is preferable to N-terminal tagging for Ugt8, as N-terminal regions appear to be subject to cleavage in cellular systems .

  • Research has shown that when both N-terminal and C-terminal FLAG-tagged mouse Ugt8 constructs were expressed, only the C-terminal tagged version was successfully detected using anti-FLAG antibodies .

Expression level control:

  • Overexpression systems should include appropriate controls to account for potential artifacts due to non-physiological enzyme levels.

  • Inducible expression systems can provide better control over expression timing and magnitude.

Verification of activity:

  • Functional assays should be performed to confirm that the recombinant protein retains enzymatic activity.

  • This typically involves measuring the production of galactosylated lipids such as GalCer and MGDG.

How can researchers effectively differentiate between Ugt8's different enzymatic activities?

To differentiate between Ugt8's enzymatic activities toward different substrates:

Substrate-specific assays:

  • Specific substrates can be provided in in vitro assays to determine activity toward different lipid classes.

  • For example, to assess MGDG synthesis versus GalCer synthesis, specific precursor lipids can be supplied.

Lipid profiling analysis:

  • LC-MS-based lipid profiling can distinguish between different galactosylated products.

  • In UGT8-knockdown cells, the MGDG content was found to be significantly decreased (92.8% reduction), while the reduction in HexCer was relatively slight (22.9%), indicating substrate preference .

Substrate competition experiments:

  • Providing multiple potential substrates simultaneously can reveal preferential activity.

  • UGT8 has been shown to preferentially utilize ether-linked DG (O-16:0_16:0) as a substrate for MGDG synthesis .

What controls are essential when studying the effects of Ugt8 inhibition?

When studying Ugt8 inhibition, several controls are critical:

Knockdown/knockout validation:

  • When using genetic approaches, verification of protein reduction/absence is essential.

  • Multiple siRNAs should be used to ensure that observed effects are due to Ugt8 reduction rather than off-target effects .

Inhibitor specificity:

  • For chemical inhibitors like zoledronic acid (ZA), specificity should be verified by comparing effects in wild-type versus Ugt8-knockout systems.

  • Dose-response relationships should be established to identify optimal concentrations.

Rescue experiments:

  • Expression of inhibitor-resistant Ugt8 variants can confirm that observed effects are specifically due to Ugt8 inhibition.

  • Wild-type Ugt8 reintroduction in knockout systems should restore the normal phenotype.

What are the emerging roles of Ugt8 in cancer biology?

Recent research has revealed significant implications of Ugt8 in cancer biology:

Associations with aggressive cancer phenotypes:

  • UGT8 expression is dramatically up-regulated in basal-like breast cancer (BLBC) and predicts poor prognosis in breast cancer patients .

  • Analysis of multiple gene expression datasets (GSE12777, GSE10890, E-TABM-157, and E-MTAB-181) has consistently shown significantly higher UGT8 expression in BLBC cell lines compared to other breast cancer subtypes .

Mechanistic insights:

  • UGT8 appears to promote BLBC progression through activating the sulfatide–αVβ5 axis, providing tumorigenic and metastatic advantages .

  • Knockdown of UGT8 expression causes a remarkable decrease in both GalCer and sulfatide levels, while exogenous UGT8 expression results in dramatic increases in these lipids .

Therapeutic potential:

  • Inhibition of UGT8 has been suggested as a promising opportunity for treating BLBC .

  • Zoledronic acid (ZA) has been identified as a potential direct inhibitor of UGT8 that may suppress BLBC progression .

How can researchers integrate Ugt8 studies with broader lipid metabolism research?

Integrating Ugt8 research with broader lipid metabolism studies requires:

Systems biology approaches:

  • Metabolomic profiling can reveal how Ugt8 activity influences global lipid composition.

  • Pathway analysis can identify connections between Ugt8 function and other lipid metabolic pathways.

Cross-disciplinary techniques:

  • Combining lipidomics with transcriptomics or proteomics can provide comprehensive views of how Ugt8 fits into cellular lipid regulatory networks.

  • Structural biology approaches can elucidate the molecular mechanisms of Ugt8's substrate specificity and catalytic activity.

Physiological context:

  • Studies in primary cells and tissues rather than just cell lines can provide more physiologically relevant insights.

  • Animal models with tissue-specific Ugt8 modulation can reveal context-dependent functions.

What technological advances might enhance future Ugt8 research?

Several technological advances hold promise for advancing Ugt8 research:

Advanced imaging techniques:

  • Super-resolution microscopy could provide detailed insights into Ugt8's subcellular localization and association with specific membrane domains.

  • Label-free imaging technologies like Raman microscopy might allow direct visualization of Ugt8-produced lipids in living cells.

Structural biology approaches:

  • Cryo-electron microscopy could potentially reveal the three-dimensional structure of Ugt8 and its interactions with substrates.

  • Molecular dynamics simulations based on structural data could predict the effects of mutations or inhibitors.

CRISPR-based technologies:

  • CRISPRi and CRISPRa systems could allow for more precise temporal control of Ugt8 expression.

  • Base editing or prime editing could enable the introduction of specific point mutations to study structure-function relationships without complete gene disruption.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.