Recombinant Rat 2-oxoglutarate receptor 1 (Oxgr1)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Research Applications

Recombinant Oxgr1 is utilized to study its role in:

  • Ligand Binding: αKG and itaconate activate Oxgr1 at millimolar concentrations, triggering intracellular Ca²⁺ signaling and Gq/11-mediated pathways .

  • Cysteinyl Leukotriene Interactions: LTE4 binding to Oxgr1 regulates airway inflammation and brush cell proliferation in respiratory tissues .

  • Metabolic Regulation: Oxgr1 modulates glucose and lipid metabolism in skeletal muscle, influencing capillary density and fiber-type composition .

Cardiac Hypertrophy

Oxgr1 ablation in mice exacerbates pressure overload-induced hypertrophy, while its overexpression reduces cardiomyocyte enlargement. Mechanistically, Oxgr1 interacts with CSN5 (COP9 subunit 5) to suppress STAT3 signaling, a pro-hypertrophic pathway .

Renal Function

In diabetic models, Oxgr1 mediates αKG-induced upregulation of the (pro)renin receptor (PRR) and GLUT1 in collecting duct cells, contributing to sodium retention and angiotensin II formation .

Skeletal Muscle Metabolism

Oxgr1 knockout mice exhibit reduced muscle mass, capillary density, and oxidative fiber content. Recombinant Oxgr1 may be used to study its role in vascular smooth muscle relaxation and metabolic adaptation .

Methodological Insights

Recombinant Oxgr1 is validated for:

  • ELISA/Western Blotting: Antibodies like A12225 (Boster Bio) detect Oxgr1 in rat tissues and recombinant proteins .

  • Functional Assays: αKG-induced Ca²⁺ influx and ERK phosphorylation are quantified in Xenopus oocytes expressing Oxgr1 .

Clinical and Therapeutic Implications

  • Target Validation: Recombinant Oxgr1 aids in identifying antagonists (e.g., ML) to inhibit pathways linked to asthma, diabetes, or cardiac disease .

  • Drug Development: Structural studies using recombinant Oxgr1 inform the design of small-molecule modulators targeting its hydrophobic pocket (e.g., ARG110, HIS114 residues) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Oxgr1; Gpr80; P2y15; 2-oxoglutarate receptor 1; Alpha-ketoglutarate receptor 1; G-protein coupled receptor 80; P2Y purinoceptor 15; P2Y15
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MIETLDSPANDSDFLDYITALENCTDEQISFKMQYLPVIYSIIFLVGFPGNTVAISIYVF KMRPWKSSTIIMLNLALTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFGFHFNLYSS ILFLTCFSLFRYIVIIHPMSCFSIQKTRWAVVACAGVWVISLVAVMPMTFLITSTTRTNR SACLDLTSSDDLTTIKWYNLILTATTFCLPLLIVTLCYTTIISTLTHGPRTHSCFKQKAR RLTILLLLVFYVCFLPFHILRVIRIESRLLSISCSIESHIHEAYIVSRPLAALNTFGNLL LYVVVSNNFQQAFCSAVRCKAIGDLEQAKKDSCSNNP
Uniprot No.

Target Background

Function
Oxgr1 is a receptor for alpha-ketoglutarate, acting exclusively via a G(q)-mediated pathway.
Gene References Into Functions
  1. P2Y15 is a cell surface receptor for AMP and adenosine. PMID: 15001573
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in mast cells and is found predominantly in the tissues of the respiratory tract and kidneys.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.