Recombinant Rat 3 beta-hydroxysteroid dehydrogenase type 5 (Hsd3b5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Hsd3b5; Hsd3b; NADPH-dependent 3-keto-steroid reductase Hsd3b5; 3 beta-hydroxysteroid dehydrogenase type 3; 3 beta-hydroxysteroid dehydrogenase type III; 3 beta-HSD III; Dihydrotestosterone 3-ketoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Hsd3b5
Target Protein Sequence
PGWSCLVTGAGGFLGQRIVQMLVQEKELQEVRVLYRTFSPKHKEELSKLQTKAKVTVLRG DIVDAQFLRRACQGMSVIIHTAAALDIAGFLPRQTILDVNVKGTQLLLDACVEASVPAFI YSSSTGVAGPNSYKETILNDREEEHRESTWSNPYPYSKRMAEKAVLAANGSILKNGGTFH TCALRLPFIYGEESQIISTMVNRALKNNSIIKRHATFSIANPVYVGNAAWAHILAARGLR DPEKSQSIQGQFYYISDDTPHQSYDDLNYTLSKEWGFCLDSSWSLPLPLLYWLAFLLETV SFLLRPFYNYRPPFNRFMVTILNSVFTISYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ
Uniprot No.

Target Background

Function
Recombinant Rat 3 beta-hydroxysteroid dehydrogenase type 5 (Hsd3b5) reduces the oxo group at the C-3 position of 5α-androstane steroids. It catalyzes the conversion of dihydrotestosterone to its inactive form, 5α-androstanediol, which does not bind to the androgen receptor (AR). Additionally, it converts androstanedione (a precursor to testosterone and estrone) to epiandrosterone. It does not function as an isomerase.
Gene References Into Functions
  1. Hsd3b expression throughout the spinal cord persists even after castration and adrenalectomy, suggesting endogenous progesterone production and a significant signaling role for this steroid in the spinal cord. PMID: 12182894
  2. In ovariectomized-adrenalectomized rats, estrogen treatment increased 3β-HSD mRNA levels in the hypothalamus. PMID: 16020475
  3. Traumatic brain injury in the frontal cortex resulted in a significant decrease in 3β-HSD mRNA expression in both male and pseudopregnant female rats. PMID: 17428656
  4. The interaction between ERα, transcriptional coregulators, histone acetylases (CBP/SRC-1), and PGC-1α is essential for FSH and TGFβ1-upregulated expression of Hsd3b and Cyp11a1, leading to progesterone production in rat ovarian granulosa cells. PMID: 18511507
Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Expressed predominantly in male liver.

Q&A

What is Rat Hsd3b5 and what distinguishes it from other 3β-HSD isoforms?

Rat Hsd3b5 (3 beta-hydroxysteroid dehydrogenase type 5) is a member of the 3β-hydroxysteroid dehydrogenase family but with distinct functional properties. Unlike the genuine NAD+/H-dependent 3β-HSD isoenzymes (types I, II, and IV), which catalyze both dehydrogenase and isomerase activities, Hsd3b5 functions primarily as a specific 3-keto-reductase (3-KSR) . This liver-specific enzyme is responsible for the reduction of the oxo group on the C-3 of 5alpha-androstane steroids and catalyzes the conversion of dihydrotestosterone (DHT) to its inactive form 5alpha-androstanediol, which does not bind to androgen receptor/AR . Importantly, Hsd3b5 does not function as an isomerase, distinguishing it functionally from other family members .

What is the tissue distribution and sex-specificity of Hsd3b5?

Hsd3b5 demonstrates a highly specific expression pattern, being a male-specific enzyme found almost exclusively in the liver . This sex-specific expression pattern suggests hormonal regulation and specialized functions in male steroid metabolism. The restricted tissue distribution contrasts with other 3β-HSD family members that show broader expression patterns across adrenal glands, gonads, and other tissues . Understanding this sex-specificity is critical when designing experiments, as female rat tissues will show minimal Hsd3b5 expression.

How does Hsd3b5 contribute to steroid hormone metabolism?

Hsd3b5 plays a crucial role in the inactivation pathway of androgens, particularly dihydrotestosterone (DHT) . As a 3-keto-reductase, it catalyzes the conversion of DHT to 5α-androstanediol, effectively reducing the potency of this androgen by producing a metabolite that cannot bind to androgen receptors . Additionally, it can metabolize 5α-androstane-3,17-dione (A-dione) into its 3β-hydroxy derivative . This enzymatic activity represents an important regulatory mechanism in androgen metabolism and may impact androgen-dependent physiological processes in male rats.

What is the molecular structure of rat Hsd3b5?

Rat Hsd3b5 is encoded by a cDNA that translates to a protein of 372 amino acids . The gene is officially designated as Hsd3b5 (previously known as 3β-HSD V) with the accession number NM_012584.2 . Although the three-dimensional structure has not been fully resolved, sequence analysis reveals high homology (94%) with other family members like types I and II 3β-HSD . The protein contains domains necessary for substrate binding and catalytic activity, with specific residues that determine its reductase activity rather than dehydrogenase/isomerase activities found in other family members.

What are the enzymatic properties of recombinant Hsd3b5?

Recombinant Hsd3b5 exhibits specific 3-keto-reductase activity. In experimental systems using transient expression in human cell lines (HeLa, JEG-3, or SW-13), the enzyme efficiently catalyzes the reduction of DHT to 3β-diol . This is in contrast to type I 3β-HSD, which primarily increases the formation of DHT from 3β-diol . The enzyme demonstrates NADPH-dependence for its reducing activity, which is consistent with its classification as an NADPH-dependent 3-beta-hydroxy-Delta(5)-steroid dehydrogenase .

What are effective methods for expressing recombinant Hsd3b5?

Based on published research, several effective approaches for expressing recombinant rat Hsd3b5 include:

  • Adenoviral expression systems: Commercial adenoviral vectors containing the Hsd3b5 gene (NM_012584.2) under a CMV promoter provide high transduction efficiency (nearly 100%) in mammalian cells . This system is particularly useful for short-term expression studies (approximately 7 days).

  • Transient transfection in human cell lines: Successful expression has been demonstrated in multiple human cell lines including HeLa cervical carcinoma cells, which allow for functional enzymatic studies . When designing expression constructs, incorporating the complete coding sequence (1122 bp) is essential for functional expression .

  • Hybridoma-based approaches: For generating antibodies against Hsd3b5, high-throughput selection methods using hybridoma technology can be employed, followed by recombinant antibody production using cloned variable regions .

The choice of expression system should be guided by the specific research questions and downstream applications.

How can I measure Hsd3b5 enzyme activity in experimental systems?

Measurement of Hsd3b5 activity can be performed using several complementary approaches:

  • Substrate conversion assays: The primary method involves incubating recombinant Hsd3b5 with its substrates (DHT or A-dione) and measuring the formation of 3β-hydroxy metabolites. Typically, radiolabeled substrates are used, followed by separation techniques such as thin-layer chromatography or HPLC .

  • Cell-based assays: In intact cells expressing Hsd3b5, conversion of DHT to 3β-diol can be monitored over time to assess enzymatic activity under more physiological conditions .

  • Comparative analysis: To distinguish Hsd3b5 activity from other 3β-HSD isoforms, parallel experiments using cells expressing different isoforms can reveal the specific activity profile of Hsd3b5 (3-keto-reductase) versus the dehydrogenase/isomerase activities of other family members .

  • ELISA-based detection: For quantitative measurement of Hsd3b5 protein levels, sandwich ELISA methods with appropriate antibodies can be employed, with a sensitivity of approximately 46.875 pg/ml and a detection range of 78.125-5000 pg/ml .

What are appropriate controls for Hsd3b5 functional studies?

When designing experiments to study Hsd3b5 function, the following controls should be considered:

  • Isoform comparisons: Include parallel experiments with other 3β-HSD isoforms (particularly types I and IV) to highlight the unique reductase activity of Hsd3b5 .

  • Sex-matched controls: Given the male-specific expression of Hsd3b5, experiments should include appropriate sex-matched controls; female liver samples serve as natural negative controls .

  • Inhibitor studies: Use specific inhibitors of 3β-HSD activities to confirm the enzymatic mechanism.

  • Empty vector controls: For recombinant expression studies, cells transfected with empty vectors are essential to control for endogenous activities.

  • Substrate controls: Include substrate-only incubations without enzyme to account for non-enzymatic conversions.

How is Hsd3b5 expression regulated in physiological and pathological states?

Research has revealed several key insights into Hsd3b5 regulation:

Dietary influences: Hsd3b5 expression levels are significantly affected by dietary factors. In mice fed a high-fat diet supplemented with resveratrol (which prevents hepatic steatosis), Hsd3b5 expression is higher compared to controls fed only a high-fat diet . This suggests a potential role in metabolic adaptation to dietary challenges.

Hepatic pathology: In models of hepatic dysfunction, Hsd3b5 expression can be dramatically reduced. For example, in one study examining hepatic gene expression profiles, Hsd3b5 levels were decreased to approximately 26% of control values (0.26 ± 0.49 range) . This table summarizes key findings on Hsd3b5 expression changes:

ConditionHsd3b5 Expression (relative to control)Reference
HF diet + resveratrolIncreased
Hepatic dysfunction model0.26 ± 0.49
Female vs. Male liverMinimal expression in females

Developmental regulation: The expression pattern of Hsd3b5 is developmentally regulated, with expression increasing during sexual maturation in male rats, consistent with its role in androgen metabolism.

What are the known protein interactions of Hsd3b5 in steroid metabolism pathways?

Hsd3b5 functions within a complex network of steroid-metabolizing enzymes. Protein interaction analysis reveals several key functional partners:

  • Cyp7b1 (Cytochrome P450 7B1): A strong functional association (score 0.981) exists between Hsd3b5 and Cyp7b1, which is involved in the 7α-hydroxylation of steroids and neurosteroids .

  • Cyp7a1 (Cytochrome P450 7A1): This enzyme, critical for bile acid biosynthesis and cholesterol homeostasis, shows significant functional connection with Hsd3b5 (score 0.952) .

  • Cyp17a1 (Steroid 17-alpha-hydroxylase/17,20 lyase): Involved in corticoid and androgen biosynthesis, this enzyme functionally interacts with Hsd3b5 in steroid metabolism pathways .

These interactions suggest that Hsd3b5 functions as part of an integrated enzymatic network regulating multiple aspects of steroid metabolism beyond its direct catalytic role in androgen inactivation.

How can I design experiments to study the phenotypic consequences of Hsd3b5 manipulation?

To investigate the physiological role of Hsd3b5 through gain or loss of function approaches:

  • Adenoviral overexpression: Utilize adenoviral vectors carrying Hsd3b5 (available commercially with titers >1×10^6 pfu/mL) for transient overexpression in liver cells or for in vivo liver-directed gene transfer. This approach is particularly useful for examining short-term effects on androgen metabolism.

  • Genetic knockout models: While specific Hsd3b5 knockout models are not directly described in the provided search results, the PXR knockout mouse model (C57Bl/6NTac PXR−/−) has been used to study liver metabolism and could potentially reveal Hsd3b5-related phenotypes.

  • Pharmacological studies: Administration of compounds that modulate Hsd3b5 expression (like resveratrol) can provide insights into its regulation and function .

  • RNA interference: Design siRNAs or shRNAs targeting Hsd3b5 for selective knockdown in liver cells or in vivo.

  • Correlation studies: Analyze correlations between Hsd3b5 expression levels and relevant physiological parameters (androgen levels, liver function) across existing rat models like the HXB/BXH recombinant inbred strain platform .

How should I interpret changes in Hsd3b5 expression in microarray or RNA-Seq studies?

When analyzing gene expression data for Hsd3b5:

  • Consider sex-specific expression: Given the male-specific nature of Hsd3b5, changes in mixed-sex samples may be diluted or confounded. Always separate male and female data in analysis .

  • Normalize appropriately: For microarray analysis, normalization methods that account for the distribution of fold changes are recommended. In one study, a novel non-parametric algorithm was used for gene expression analysis that helped differentiate Hsd3b5 expression changes .

  • Biological context interpretation: Changes in Hsd3b5 should be interpreted in the context of:

    • Other steroid-metabolizing enzymes, particularly those in the same pathway

    • Androgen-responsive genes that may be affected by altered DHT metabolism

    • Liver function markers that may correlate with Hsd3b5 expression

  • Validation strategies: Significant changes in Hsd3b5 expression should be validated using:

    • qRT-PCR for mRNA levels

    • Western blotting for protein levels

    • Enzymatic activity assays to confirm functional consequences

    • In situ hybridization to confirm tissue localization

What methodological approaches can help resolve contradictory findings related to Hsd3b5 function?

When faced with conflicting data about Hsd3b5 function:

  • Isoform specificity verification: Confirm that the observed activities are indeed attributable to Hsd3b5 and not other 3β-HSD isoforms. Use isoform-specific primers for RNA quantification and specific antibodies for protein detection .

  • Substrate specificity analysis: Comprehensive substrate panels can help distinguish between the reductase activity of Hsd3b5 and the dehydrogenase/isomerase activities of other family members .

  • Cell type considerations: Results may differ based on the cellular context. The liver-specific nature of Hsd3b5 means that findings in non-hepatic cells should be interpreted cautiously .

  • Species differences: While the focus is on rat Hsd3b5, be aware that rodent steroid metabolism can differ significantly from human pathways. Mouse and rat 3β-HSD enzymes also show important differences .

  • Methodological standardization: Use standardized assay conditions, particularly with respect to cofactor concentrations (NADPH), pH, and incubation times for enzymatic assays .

What are promising research avenues for further understanding Hsd3b5 function?

Several promising directions for advancing Hsd3b5 research include:

  • Mechanistic studies of sex-specific regulation: Investigating the transcriptional and epigenetic mechanisms underlying the male-specific expression pattern of Hsd3b5 could reveal important insights into sex-biased liver metabolism.

  • Role in metabolic disorders: Given the altered expression in resveratrol-treated high-fat diet models , exploring Hsd3b5's potential role in metabolic disorders and non-alcoholic fatty liver disease (NAFLD) represents an important research direction.

  • Impact on androgen signaling: While Hsd3b5 is known to inactivate DHT, the broader consequences of this activity on androgen-responsive pathways in the liver and other tissues remains to be fully characterized.

  • Structural biology approaches: Determining the three-dimensional structure of Hsd3b5 would facilitate understanding of its unique substrate specificity and could enable structure-based drug design for metabolic disorders.

  • Single-cell transcriptomics: Applying single-cell RNA sequencing to investigate potential heterogeneity in Hsd3b5 expression across liver lobules and in different physiological states.

What technological advances might enhance research on Hsd3b5?

Emerging technologies that could significantly advance Hsd3b5 research include:

  • CRISPR/Cas9 gene editing: Generation of precisely engineered rat models with Hsd3b5 modifications, including conditional knockouts and point mutations to dissect structure-function relationships.

  • Metabolomics integration: Combining Hsd3b5 expression studies with untargeted metabolomics to identify novel substrates and metabolic pathways affected by this enzyme.

  • Proteomics approaches: Investigation of the Hsd3b5 interactome through proximity labeling methods could reveal novel protein interactions and regulatory mechanisms.

  • In vivo imaging: Development of activity-based probes or reporter systems to monitor Hsd3b5 activity in living animals could provide dynamic insights into its regulation.

  • Organoid models: Liver organoids derived from male rats could provide more physiologically relevant systems for studying Hsd3b5 function than traditional cell culture models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.