Recombinant Rat 3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Hsd3b7; Cca2; 3 beta-hydroxysteroid dehydrogenase type 7; 3 beta-hydroxysteroid dehydrogenase type VII; 3-beta-HSD VII; 3-beta-hydroxy-Delta(5-C27 steroid oxidoreductase; C(27 3-beta-HSD; Cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase; Confluent 3Y1 cell-associated 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Hsd3b7
Target Protein Sequence
MADSAQVPALVYLVTGGCGFLGEHIVRMLLEWEPRLRELRVFDLHLSSWLEELKTGPVQV TAIQGDVTQAHEVAAAMAGSHVVIHTAGLVDVFGKASPETIHKVNVQGTQNVIDACVQTG TRLLVYTSSMEVVGPNVKGHPFYRGNEDTPYEAIHRHPYPCSKALAEQLVLEANGRKGLR FGGRLFRAIPASVEHGRVYVGNVAWMHILVARELEQRAALMGGQVYFCYDKSPYKSYEDF NMEFLSPCGLRLIGTHPLLPYWLLVLLTALNALLQWLLRPLVLYTPLLNPYTLAVANTTF TVSTNKAQRHFGYKPLFSWEESRARTIHWVQAMEGSAW
Uniprot No.

Target Background

Function

The 3β-hydroxysteroid dehydrogenase type 7 (3β-HSD7) enzyme system is crucial in the biosynthesis of all steroid hormone classes. HSD7 exhibits activity against four 7α-hydroxylated sterols but does not metabolize several C19/C21 steroids. It is involved in bile acid synthesis and plays a key role in lymphoid tissue cell positioning and movement by mediating the degradation of 7α,25-dihydroxycholesterol (7α,25-OHC). 7α,25-OHC acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for various lymphoid cells.

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
High levels in liver and lung, moderate levels in spleen, brain, heart, kidney, jejunum and testis. Up-regulated in 3Y1 cells upon growth arrest.

Q&A

What is the primary function of Hsd3b7 in rats?

Hsd3b7 (3β-hydroxysteroid dehydrogenase/delta5-delta4-isomerase type 7) catalyzes two critical reactions required for the inversion of the 3β-hydroxyl group of cholesterol to the 3α-hydroxyl group found in bile acids . This stereochemical modification is essential for maintaining the functional and regulatory properties of bile acids in the enterohepatic circulation. The enzyme specifically contributes to primary bile acid synthesis from cholesterol in the liver, after which these bile acids are secreted into the bile and small intestine . The importance of this enzyme is underscored by studies showing that mutations inactivating this gene in humans cause a recessive form of neonatal liver failure .

How is Hsd3b7 expression regulated in rat tissues?

While the search results do not directly address the regulation of Hsd3b7 specifically, we can infer some information from related 3β-HSD studies. In rats, 3β-HSD expression has been identified throughout the spinal cord from cervical to sacral segments, with region-specific distribution patterns . Expression is particularly pronounced in the dorsal horn (layers I-III), followed by the central canal (layer X), and ventral horn (layers VIII-IX) . Interestingly, castration and adrenalectomy do not influence the expression of 3β-HSD mRNA and protein in the spinal cord, suggesting that its expression in neural tissues is not directly regulated by gonadal or adrenal steroids .

What is the genomic structure of rat Hsd3b7?

The mouse Hsd3b7 gene, which is likely similar to the rat ortholog, is relatively small at approximately 2.7 kb and consists of six exons . This compact genomic structure facilitated the development of knockout models that replaced the entire gene with a selection cassette. For recombinant expression studies, understanding this genomic organization is essential for designing appropriate expression constructs that maintain the functional integrity of the enzyme .

How does the structure of Hsd3b7 influence its substrate specificity compared to other hydroxysteroid dehydrogenases?

The substrate specificity of hydroxysteroid dehydrogenases is determined by specific structural elements, particularly loops within the protein structure. While not specific to Hsd3b7, studies on related enzymes like 3α-HSD have demonstrated how protein engineering can alter substrate specificity . By comparing the steroid binding pockets at the atomic level and replacing specific loops, researchers converted 3α-HSD into a 20α-HSD, changing the enzyme's positional and stereospecific activity . For Hsd3b7, the specific residues that confer its unique substrate specificity likely reside within similar loop structures that position the steroid substrate relative to the catalytic residues. Research indicates that the specificity for the 3β-hydroxyl group is crucial for the enzyme's physiological role in bile acid synthesis .

What are the phenotypic consequences of Hsd3b7 knockout in experimental models?

Hsd3b7 knockout mice provide valuable insights into the enzyme's physiological significance. Elimination of Hsd3b7 prevents epimerization of the hydroxyl group at carbon 3 of the sterol nucleus, resulting in the synthesis of 3β-hydroxylated bile acids instead of the normal 3α-hydroxylated forms . This stereochemical alteration has profound consequences:

  • It causes death in 90% of newborn mice

  • It eliminates cholesterol absorption in the gut

  • It disrupts negative feedback regulation of bile acid synthesis mediated by the farnesoid X receptor (FXR)

  • It leads to a 3.5-fold increase in de novo cholesterol synthesis in the liver and smaller but significant increases in the duodenal and jejunal segments of the small intestine

  • It causes modest increases in fatty acid synthesis (approximately 20%) in the liver

These findings emphasize that the correct stereochemistry of the 3-hydroxyl group is essential for bile acids to maintain their physiologic and regulatory functions in mammals.

How can recombinant Hsd3b7 be used to study the mechanistic details of bile acid synthesis disorders?

Recombinant Hsd3b7 provides a powerful tool for studying the mechanistic details of bile acid synthesis disorders. By creating specific mutations in the recombinant enzyme, researchers can mimic human disease-causing variants and assess their impact on enzyme activity, substrate specificity, and protein stability. This approach can be particularly valuable for understanding the molecular pathogenesis of neonatal liver failure associated with HSD3B7 mutations in humans .

Studies with recombinant hydroxysteroid dehydrogenases have demonstrated how catalytic efficiency (kcat/Km) reflects both the chemical step (governed by catalytic residues) and the binding and release of substrates . For Hsd3b7, similar kinetic analyses could elucidate how disease-causing mutations affect these parameters, potentially leading to targeted therapeutic approaches.

What are the optimal conditions for expressing recombinant rat Hsd3b7?

While the search results don't provide specific protocols for Hsd3b7 expression, lessons can be drawn from related hydroxysteroid dehydrogenase expression systems. Based on the expression of related enzymes, prokaryotic expression vectors like pKK or pET systems have been successfully used for recombinant expression of hydroxysteroid dehydrogenases . These systems typically involve:

  • Cloning the full-length cDNA into an appropriate expression vector with a strong promoter

  • Transformation into a suitable E. coli strain (e.g., BL21(DE3))

  • Induction of protein expression using IPTG

  • Cell lysis and protein purification through affinity chromatography

For rat Hsd3b7 specifically, consideration should be given to codon optimization for the expression host and the potential need for molecular chaperones to ensure proper folding of the recombinant protein.

What techniques are most effective for assessing Hsd3b7 enzymatic activity?

Several approaches can be used to assess the enzymatic activity of recombinant Hsd3b7:

  • Spectrophotometric assays: The reduction of NAD+ to NADH during the oxidation of 3β-hydroxy steroids can be monitored by measuring the increase in absorbance at 340 nm .

  • Radiometric assays: Using radiolabeled substrates (e.g., [14C]progesterone) followed by chromatographic separation and detection of products .

  • Mass spectrometry: Gas chromatography/mass spectrometry can be used to measure the conversion of cholesterol to bile acids and quantify specific intermediates in the pathway .

  • In vivo isotope incorporation assays: In cellular or animal models, the incorporation of isotope-labeled substrates (e.g., 3H2O) can be used to measure the impact of Hsd3b7 activity on cholesterol synthesis rates .

Each method offers different advantages in terms of sensitivity, specificity, and throughput, and the choice depends on the specific research question being addressed.

How can researchers distinguish between the activities of different hydroxysteroid dehydrogenase isoforms in mixed samples?

Distinguishing between different hydroxysteroid dehydrogenase isoforms in mixed samples presents a significant analytical challenge. Several approaches can be employed:

  • Substrate specificity profiling: Different isoforms often exhibit distinct substrate preferences and kinetic parameters. By testing activity across a panel of substrates, researchers can develop a "fingerprint" of the relative activities that can help identify the predominant isoforms present .

  • Selective inhibitors: When available, isoform-specific inhibitors can be used to selectively block particular enzymes in a mixed sample.

  • Immunological methods: Western blotting with isoform-specific antibodies can quantify the relative abundance of different isoforms .

  • Molecular biology approaches: In situ hybridization using oligonucleotide probes specific for different isoforms can distinguish their expression patterns in tissues .

The table below summarizes key differences between rat Hsd3b7 and related hydroxysteroid dehydrogenases that can be used for discrimination:

ParameterHsd3b73α-HSD (AKR1C9)20α-HSD (AKR1C8)
Primary substrateCholesterol intermediates5α-DHTProgesterone
Primary product3α-hydroxylated bile acids3α-androstanediol20α-hydroxyprogesterone
Tissue expressionPredominantly liverLiver, prostateOvary, placenta
Molecular weight~33 kDaVariable by isoformVariable by isoform
Catalytic residuesNot fully characterizedTyr-55, His-117, Lys-84, Asp-50Similar to 3α-HSD

What are the key considerations when analyzing data from Hsd3b7 knockout models?

When analyzing data from Hsd3b7 knockout models, several important considerations should be taken into account:

  • High neonatal mortality: Since approximately 90% of Hsd3b7 knockout mice die as newborns, researchers must consider potential selection bias in surviving animals, which may represent less severely affected individuals .

  • Compensatory mechanisms: The knockout animals show significant upregulation of de novo cholesterol synthesis in the liver and small intestine, indicating the activation of compensatory pathways . These adaptations may mask or complicate the interpretation of primary phenotypes.

  • Regional variations: The effects of Hsd3b7 knockout vary by tissue, with different impacts on cholesterol synthesis in the liver, various segments of the intestine, kidney, and spleen . This spatial heterogeneity must be considered when designing experiments and analyzing results.

  • Genotype verification: Thorough verification of the knockout at both mRNA and protein levels is essential. This typically involves RT-PCR and Western blot analyses to confirm the absence of functional Hsd3b7 .

  • Age and sex differences: While not explicitly mentioned in the search results, many steroid-related phenotypes show age and sex-dependent variations that should be systematically analyzed.

What are common challenges in expressing active recombinant Hsd3b7 and how can they be addressed?

Researchers often encounter several challenges when working with recombinant Hsd3b7:

  • Protein insolubility: As a membrane-associated enzyme, Hsd3b7 may show limited solubility when expressed in prokaryotic systems. This can be addressed by using fusion tags (e.g., MBP or SUMO), optimizing expression temperature (typically lowering to 16-20°C), or employing specialized E. coli strains designed for membrane protein expression.

  • Cofactor requirements: Ensuring the presence of appropriate cofactors (NAD+/NADP+) in activity assays is essential for detecting enzyme function . Some preparations may benefit from pre-incubation with cofactors to stabilize the enzyme.

  • Substrate presentation: The hydrophobic nature of steroid substrates may require optimization of solubilization methods, potentially using cyclodextrins or appropriate detergents that don't interfere with enzyme activity.

  • Post-translational modifications: If eukaryotic post-translational modifications are required for full Hsd3b7 activity, expression in yeast, insect, or mammalian cells may be necessary instead of bacterial systems.

How can researchers validate that their recombinant Hsd3b7 retains native structure and function?

Validation of recombinant Hsd3b7 structure and function should include multiple approaches:

  • Enzymatic activity assays: Comparing the kinetic parameters (Km, kcat, substrate specificity) of the recombinant enzyme with those reported for the native enzyme or with theoretical predictions based on structural models .

  • Structural characterization: Circular dichroism spectroscopy can provide information about secondary structure content, while thermal shift assays can assess protein stability and proper folding.

  • Complementation studies: Introducing the recombinant Hsd3b7 into knockout cells to determine if it rescues the phenotype provides strong functional validation .

  • Binding studies: Assessing the binding of cofactors and substrates using techniques such as isothermal titration calorimetry or surface plasmon resonance can validate proper folding of binding sites.

  • Immunological recognition: If antibodies against the native enzyme are available, their reactivity with the recombinant protein can provide evidence of structural similarity.

What are promising applications of recombinant Hsd3b7 in therapeutic development for bile acid synthesis disorders?

Recombinant Hsd3b7 holds significant potential for therapeutic development in several areas:

  • Enzyme replacement therapy: For patients with inactivating mutations in HSD3B7, direct enzyme replacement could theoretically restore normal bile acid synthesis, though delivery to hepatocytes presents significant challenges.

  • High-throughput screening platforms: Recombinant Hsd3b7 can be used to screen for small molecule activators that might enhance the function of partially active mutant enzymes in patients with bile acid synthesis disorders .

  • Structure-based drug design: Detailed structural understanding of Hsd3b7, potentially facilitated by recombinant protein crystallography, could enable the design of pharmacological chaperones to stabilize mutant enzymes.

  • Gene therapy vectors: Studies with recombinant Hsd3b7 can inform the development of gene therapy approaches by identifying the minimal functional enzyme components required for therapeutic efficacy.

How might techniques from protein engineering studies of other hydroxysteroid dehydrogenases be applied to Hsd3b7?

Protein engineering approaches demonstrated with related enzymes offer exciting possibilities for Hsd3b7 research:

  • Loop swapping: As demonstrated with 3α-HSD conversion to 20α-HSD, exchanging specific loops between hydroxysteroid dehydrogenases can dramatically alter substrate specificity . Similar approaches could be applied to engineer Hsd3b7 variants with novel functions or improved catalytic properties.

  • Site-directed mutagenesis: Targeted mutation of substrate binding residues can fine-tune specificity and activity . For Hsd3b7, this approach could create variants capable of processing non-native substrates or functioning under altered conditions.

  • Chimeric enzymes: Creating chimeric proteins that combine domains from Hsd3b7 with those from other hydroxysteroid dehydrogenases could yield enzymes with hybrid properties useful for both research and biotechnological applications .

  • Catalytic optimization: Understanding how the catalytic tetrad (Tyr, His, Lys, Asp) influences reaction rate and specificity in related enzymes provides a framework for engineering Hsd3b7 variants with enhanced catalytic efficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.