Recombinant Rat 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Hsd3b; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase; Steroid Delta-isomerase; Delta-5-3-ketosteroid isomerase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Hsd3b
Target Protein Sequence
PGWSCLVTGAGGFVGQRIIRMLVQEKELQEVRALDKVFRPETKEEFSKLQTKAKVTMLEG DILDAQYLRRACQGISVVIHTASVMDFSRVLPRQTILDVNLKGTQNLLEAGIHASVPAFI YCSTVDVAGPNSYKKTILNGREEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLH TCALRPMYIYGERGQFLSRIIIMALKNKGVLNVTGKFSIVNPVYVGNVAWAHILAARGLR DPKKSQNIQGQFYYISDDTPHQSYDDLNCTLSKEWGLRLDSSWSLPLPLLYWLAFLLETV SFLLRPFYNYRPPFNCHLVTLSNSKFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ
Uniprot No.

Target Background

Function

3β-HSD is a bifunctional enzyme catalyzing the oxidative conversion of Δ5-ene-3β-hydroxy steroids and the oxidative conversion of ketosteroids. The 3β-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of steroid hormones.

Gene References Into Functions
  1. Letrozole-induced polycystic ovaries showed increased 3β-HSD expression. PMID: 19698287
Database Links

KEGG: rno:682974

UniGene: Rn.128814

Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Adrenal glands, testes and ovaries.

Q&A

What is the molecular structure of rat 3β-HSD type 2 and how does it differ from type 1?

Rat 3β-HSD type 2 is a 372 amino acid protein that shares approximately 94% sequence homology with the type 1 isoform. Both isoenzymes are encoded by distinct cDNAs isolated from rat ovary lambda gt11 cDNA libraries. The calculated molecular mass of type II is approximately 42,150 daltons, slightly higher than the 41,911 daltons of type I. Despite their high sequence similarity, the two proteins exhibit different enzymatic activities when expressed in cell systems, with type I demonstrating higher catalytic efficiency for both delta 5-pregnene and delta 5-androstene precursors .

Structurally, both enzymes contain NAD+/H-dependent dehydrogenase domains and isomerase regions necessary for their bifunctional activity. The key differences likely reside in specific amino acid substitutions that affect substrate binding affinity and catalytic efficiency, contributing to their tissue-specific roles in steroid metabolism .

What expression systems are most effective for producing functional recombinant rat 3β-HSD type 2?

For functional expression of recombinant rat 3β-HSD type 2, mammalian cell systems have proven most effective, particularly human cell lines such as HeLa cervical carcinoma cells, JEG-3 choriocarcinoma cells, and SW-13 adrenal cortex adenocarcinoma cells. These systems provide the appropriate cellular environment, including cofactor availability and post-translational modification capabilities necessary for proper enzyme function .

Transient transfection using expression vectors containing the full-length type II cDNA under a strong promoter (such as CMV) yields functional protein that demonstrates both 3β-hydroxysteroid dehydrogenase and delta 5-delta 4 isomerase activities. For optimal enzymatic activity, the expression system should maintain appropriate NAD+/NADPH ratios, as these cofactors significantly influence the predominant metabolic pathways catalyzed by the enzyme .

Alternative prokaryotic expression systems can produce the protein in higher quantities but may require refolding steps to achieve full enzymatic activity due to the absence of appropriate post-translational modifications and potential issues with inclusion body formation.

What methods are recommended for purifying recombinant rat 3β-HSD type 2 while maintaining enzymatic activity?

Purification of recombinant rat 3β-HSD type 2 while preserving enzymatic activity requires careful consideration of the protein's membrane-associated nature and cofactor requirements. The recommended protocol includes:

  • Cell lysis using mild detergents (such as 0.5% Triton X-100 or CHAPS) in buffer containing glycerol (10-20%) and protease inhibitors to prevent degradation.

  • Initial purification through ammonium sulfate fractionation (30-60% saturation), which helps to remove many contaminating proteins.

  • Affinity chromatography using NAD+-agarose or substrate analogue columns, which exploits the enzyme's cofactor binding properties.

  • Size exclusion chromatography as a final polishing step to separate the 42-kDa target protein from contaminants.

Throughout the purification process, it is critical to maintain a reducing environment (typically with 1-5 mM DTT or β-mercaptoethanol) and to include stabilizers such as glycerol. Activity assays using [14C]pregnenolone or [14C]dehydroepiandrosterone as substrates should be performed after each purification step to monitor retention of enzymatic function. Western blot analysis using antibodies raised against 3β-HSD can confirm the presence of the target 42-kDa protein band .

How can researchers accurately measure the dual dehydrogenase and isomerase activities of recombinant rat 3β-HSD type 2?

Accurate measurement of the dual enzymatic activities of recombinant rat 3β-HSD type 2 requires specialized assays that can distinguish between the 3β-hydroxysteroid dehydrogenase and delta 5-delta 4 isomerase reactions. A comprehensive approach involves:

  • Radiometric assays using [14C] or [3H]-labeled substrates (pregnenolone or dehydroepiandrosterone) followed by thin-layer chromatography (TLC) or HPLC separation and quantification of metabolites. This approach allows for detection of both intermediate and final products in the reaction pathway.

  • Spectrophotometric assays measuring the reduction of NAD+ to NADH at 340 nm, which specifically monitors the dehydrogenase activity component.

  • Coupled enzyme assays that link the isomerase activity to a secondary reaction with a more easily measurable output.

For optimal results, reactions should be conducted in phosphate buffer (pH 7.4) containing NAD+ (0.5-1 mM) and the appropriate substrate (10-100 μM). Time-course studies and kinetic analyses should be performed to determine Km and Vmax values for both activities. It is important to note that the availability of cofactors (NAD+ and NADPH) significantly influences the predominant metabolic pathways, with NAD+ being essential for the dehydrogenase activity .

What factors affect the ratio of dehydrogenase to isomerase activity in recombinant rat 3β-HSD type 2?

The ratio of dehydrogenase to isomerase activity in recombinant rat 3β-HSD type 2 is influenced by several key factors:

  • Cofactor availability: The relative concentrations of NAD+ (required for dehydrogenase activity) and NADPH (which affects the directionality of reactions) significantly impact which enzymatic function predominates. Higher NAD+/NADPH ratios favor the dehydrogenase activity .

  • Substrate type: Different steroid substrates may preferentially undergo either dehydrogenation or isomerization. For example, delta 5-pregnene versus delta 5-androstene precursors can show different processing patterns .

  • pH and ionic strength: The optimal pH for dehydrogenase activity (around 7.4) may differ slightly from that of isomerase activity, allowing for selective enhancement of one function over the other.

  • Cellular context: When expressed in different cell types, the enzyme may exhibit varying activity ratios due to differences in the intracellular environment and the presence of other enzymes that may compete for substrates or cofactors .

  • Post-translational modifications: Phosphorylation or other modifications may selectively affect one activity over the other.

To systematically investigate these factors, researchers should design experiments that independently vary each parameter while monitoring both activities. This approach can help determine the optimal conditions for specific research applications requiring either balanced activities or predominance of one function .

How does recombinant rat 3β-HSD type 2 contribute to dihydrotestosterone (DHT) metabolism compared to other isoforms?

Recombinant rat 3β-HSD type 2 plays a distinct role in dihydrotestosterone (DHT) metabolism compared to other isoforms, particularly types I, III, and IV. Based on research with transfected cell systems:

  • Type II 3β-HSD, like type I, primarily contributes to the formation of DHT from 3β-diol, though with somewhat lower efficiency than type I. This activity is dependent on the enzyme's dehydrogenase function .

  • In contrast, type III (which is a specific 3-keto-reductase rather than a true 3β-HSD) catalyzes the opposite reaction, converting DHT into 3β-diol .

  • Type II 3β-HSD also demonstrates secondary 17β-HSD activity, though this appears to be less pronounced than in type I and type IV isoforms. This secondary activity contributes to the conversion of DHT into androstanedione (A-dione) .

The metabolic pathway for DHT processing by type II generally follows: 3β-diol→DHT→androstanedione, though with differences in reaction rates compared to other isoforms. The predominance of each step depends on the cellular context and cofactor availability, with NAD+/NADPH ratios being particularly important determinants .

Researchers investigating DHT metabolism should consider these isoform-specific differences when designing experiments and interpreting results, as the presence of multiple 3β-HSD types in tissues can create complex metabolic networks .

What is the tissue-specific expression pattern of rat 3β-HSD type 2 compared to other isoforms?

Rat 3β-HSD type 2 exhibits a distinct tissue distribution pattern that differs from other isoforms, particularly type I. Based on RNA analysis techniques:

  • Type II mRNA is expressed in both male and female adrenal glands and gonads (ovaries and testes), indicating its importance in these primary steroidogenic tissues .

  • Unlike type I, which is also found in the kidney of both sexes, type II mRNA is absent or expressed at very low levels in renal tissue .

  • Type II mRNA is detected in female adipose tissue, suggesting a potential role in peripheral steroid metabolism in this tissue .

  • In the ovary, in situ hybridization studies have shown that both type I and type II mRNAs have similar cellular distribution patterns, with the highest expression levels observed in the corpora lutea, though type I remains the predominant form .

  • Type II expression appears to be absent or minimal in many peripheral tissues where type I is detected, including liver, prostate, seminal vesicle, skin, and various other organs .

This differential tissue expression pattern suggests distinct physiological roles for the two isoforms in steroid hormone biosynthesis and metabolism, with type II potentially having more specialized functions in the primary steroidogenic organs (adrenals and gonads) .

How does the expression of rat 3β-HSD type 2 change during development and under different physiological conditions?

The expression of rat 3β-HSD type 2 demonstrates significant plasticity throughout development and in response to various physiological states:

  • Developmental Regulation:

    • Expression increases during sexual maturation, correlating with the onset of steroidogenic capacity in gonads.

    • Fetal and neonatal tissues show distinct expression patterns compared to adult tissues, reflecting developmental-specific steroidogenic requirements.

  • Hormonal Regulation:

    • Gonadotropins (LH and FSH) upregulate type II expression in gonadal tissues, particularly during follicular development and luteinization in ovaries.

    • Adrenocorticotropic hormone (ACTH) modulates expression in adrenal tissues.

    • Sex steroids themselves can provide feedback regulation, creating complex regulatory networks.

  • Stress Conditions:

    • Chronic stress can alter expression patterns, affecting steroidogenic capacity.

    • Inflammatory conditions may induce expression in tissues that normally express minimal levels.

  • Reproductive Cycle:

    • In females, expression varies significantly during the estrous cycle, with peaks during proestrus and luteal phases when steroidogenic demand is highest.

    • Pregnancy induces substantial changes in expression patterns, particularly in the placenta and ovaries.

These dynamic expression patterns highlight the enzyme's adaptability to changing physiological demands for steroid hormones. Researchers studying developmental or condition-specific steroidogenesis should consider these temporal changes when designing experiments and selecting appropriate time points for analysis .

What are the consequences of 3β-HSD type 2 dysfunction on steroid hormone biosynthesis pathways?

Dysfunction of 3β-HSD type 2 can significantly disrupt steroid hormone biosynthesis pathways with various physiological consequences:

  • Impaired Progesterone and Mineralocorticoid Synthesis:

    • Reduced conversion of pregnenolone to progesterone affects corpus luteum function and pregnancy maintenance.

    • Decreased aldosterone production can disturb electrolyte balance and blood pressure regulation.

  • Altered Androgen and Estrogen Production:

    • Disrupted conversion of DHEA to androstenedione affects downstream testosterone and estradiol synthesis.

    • This may cause reproductive abnormalities and altered secondary sexual characteristics.

  • Shifted Steroid Ratios:

    • Accumulation of delta-5 steroid precursors (pregnenolone, 17-hydroxypregnenolone, DHEA).

    • Altered ratios of active hormones to their precursors can serve as diagnostic markers.

  • Compensatory Mechanisms:

    • Type I isoform may partially compensate in tissues where both isoforms are expressed.

    • Alternative metabolic pathways may become more prominent, potentially leading to the production of atypical steroids.

  • Tissue-Specific Effects:

    • Primary effects in adrenals and gonads where type II is predominantly expressed.

    • Secondary effects in peripheral tissues due to altered circulating hormone levels.

Understanding these consequences is essential for interpreting experimental results when studying models with altered 3β-HSD type 2 function, whether through genetic manipulation, enzyme inhibition, or pathological conditions affecting enzyme expression or activity .

What are the optimal transfection conditions for expressing functional recombinant rat 3β-HSD type 2 in mammalian cell lines?

Optimizing transfection conditions for functional expression of recombinant rat 3β-HSD type 2 requires attention to several key parameters:

  • Cell Line Selection:

    • HeLa cells, JEG-3 choriocarcinoma cells, and SW-13 adrenal cortex adenocarcinoma cells have been validated as effective hosts.

    • These cells provide appropriate cellular machinery while having minimal endogenous steroidogenic enzyme activity that could interfere with analyses .

  • Expression Vector Design:

    • Use full-length cDNA (1.7 kb) under control of a strong promoter (CMV or SV40).

    • Include a Kozak consensus sequence before the start codon to enhance translation efficiency.

    • Consider adding a small epitope tag (His, FLAG) at the C-terminus to facilitate detection and purification without compromising enzyme activity.

  • Transfection Protocol:

    • Lipid-based transfection reagents (Lipofectamine, FuGENE) typically yield higher efficiency than calcium phosphate methods.

    • Optimal DNA:lipid ratios range from 1:2 to 1:3, with 1-2 μg DNA per well in a 6-well plate format.

    • Transfect cells at 70-80% confluence for highest efficiency.

  • Post-Transfection Conditions:

    • Allow 24-48 hours for optimal protein expression before functional assays.

    • Maintain cells in medium supplemented with NAD+ precursors (nicotinamide, 1-5 mM) to ensure adequate cofactor availability.

    • Consider co-transfection with enzymes involved in NAD+ synthesis to enhance cofactor availability.

  • Verification Methods:

    • Confirm expression by Western blotting using antibodies against 3β-HSD or the epitope tag.

    • Verify cellular localization using immunofluorescence microscopy (expected localization: endoplasmic reticulum and mitochondrial membranes).

    • Assess enzymatic activity using radiometric assays with pregnenolone or DHEA as substrates .

These optimized conditions typically yield functional enzyme with both dehydrogenase and isomerase activities that can be reliably measured in intact cell assays or with cell lysates.

How can researchers effectively design experiments to compare the enzymatic properties of multiple rat 3β-HSD isoforms?

Designing experiments to compare enzymatic properties of multiple rat 3β-HSD isoforms requires a systematic approach that controls for variables while highlighting isoform-specific differences:

  • Standardized Expression System:

    • Express all isoforms in the same cell type under identical promoters to ensure comparable expression levels.

    • Confirm equal protein expression levels via Western blotting before enzymatic comparisons.

    • Consider using inducible expression systems to control expression timing and magnitude.

  • Parallel Kinetic Analysis:

    • Determine Km and Vmax parameters for each isoform using identical substrate concentration ranges (typically 0.1-100 μM).

    • Analyze multiple substrates (pregnenolone, DHEA, 3β-diol) to establish substrate preference profiles.

    • Measure cofactor (NAD+) dependency across a standardized concentration range (0.01-5 mM).

  • Pathway Tracing Methodology:

    • Use radiolabeled precursors to trace metabolic pathways.

    • Implement time-course studies (5, 15, 30, 60 minutes) to identify rate-limiting steps.

    • Employ HPLC or LC-MS/MS to identify and quantify all metabolites, including intermediates.

  • Cofactor Manipulation Experiments:

    • Systematically vary NAD+/NADPH ratios to assess how cofactor availability affects each isoform's predominant activity.

    • Include NAD+ regenerating systems to maintain stable cofactor levels during extended incubations.

  • Inhibition Studies:

    • Test isoform-selective inhibitors across a concentration gradient.

    • Determine IC50 values for each isoform-inhibitor pair.

    • Analyze inhibition kinetics (competitive, non-competitive, uncompetitive) to identify mechanistic differences.

  • Statistical Analysis:

    • Perform all experiments in triplicate at minimum.

    • Use two-way ANOVA to evaluate isoform-substrate interactions.

    • Apply appropriate statistical tests for kinetic parameter comparisons (t-tests or non-parametric alternatives) .

This comprehensive approach allows for robust comparison of enzymatic properties while controlling for experimental variables that could confound interpretation of isoform-specific differences.

What strategies help overcome challenges in solubilizing and maintaining activity of recombinant rat 3β-HSD type 2 for in vitro studies?

Recombinant rat 3β-HSD type 2 presents significant challenges for in vitro studies due to its membrane-associated nature and requirement for cofactors. Effective strategies to address these issues include:

  • Optimized Membrane Protein Solubilization:

    • Use mild detergents such as CHAPS (8-10 mM), digitonin (0.5-1%), or Triton X-100 (0.1-0.5%) that preserve native protein conformation.

    • Implement a stepwise solubilization protocol, starting with low detergent concentrations and gradually increasing if needed.

    • Include glycerol (10-20%) as a stabilizing agent during solubilization.

  • Cofactor Stabilization:

    • Supplement buffers with NAD+ (0.5-1 mM) throughout purification and storage.

    • Include NAD+-regenerating systems (lactate dehydrogenase + lactate) for extended activity assays.

    • Consider covalent attachment of NAD+ to the enzyme using chemical cross-linking methods for enhanced stability.

  • Protein Engineering Approaches:

    • Generate fusion constructs with solubility-enhancing tags (MBP, SUMO, thioredoxin) at the N-terminus.

    • Design truncated versions that retain catalytic domains while removing hydrophobic membrane-spanning regions.

    • Introduce specific point mutations that enhance solubility without compromising catalytic function.

  • Alternative Expression Formats:

    • Express the enzyme in nanodiscs or liposomes to maintain a membrane-like environment.

    • Utilize detergent-lipid mixed micelles that better mimic the native membrane environment.

    • Consider cell-free expression systems that can directly incorporate the protein into artificial membrane structures.

  • Stability Enhancement During Storage:

    • Store at -80°C in buffer containing 50% glycerol, 1 mM DTT, and 0.5 mM NAD+.

    • Add protease inhibitors to prevent degradation during storage and handling.

    • Avoid freeze-thaw cycles by preparing single-use aliquots.

  • Activity Preservation Techniques:

    • Include phospholipids (especially phosphatidylcholine) in reaction buffers to mimic membrane environment.

    • Optimize pH buffering system (typically MOPS or phosphate buffer, pH 7.2-7.4).

    • Add stabilizing agents such as trehalose or sucrose (5-10%) to prevent aggregation .

These strategies significantly improve the solubility, stability, and activity of recombinant rat 3β-HSD type 2 in vitro, enabling more reliable enzymatic assays and structural studies.

How can recombinant rat 3β-HSD type 2 be used to investigate steroid metabolism in neurodegenerative disease models?

Recombinant rat 3β-HSD type 2 serves as a valuable tool for investigating steroid metabolism in neurodegenerative disease models through several sophisticated approaches:

  • Neurosteroid Metabolism Mapping:

    • Use the recombinant enzyme in combination with brain tissue extracts to track conversion rates of pregnenolone and DHEA to their respective delta-4 metabolites in different brain regions.

    • Compare enzyme kinetics in healthy versus diseased brain tissues to identify region-specific alterations in neurosteroid metabolism.

    • Develop comprehensive metabolic maps that highlight shifts in steroid synthesis pathways in disease states.

  • Genetic Manipulation Strategies:

    • Implement viral vector-mediated overexpression of recombinant 3β-HSD type 2 in specific brain regions to evaluate the neuroprotective effects of enhanced local neurosteroid production.

    • Design siRNA or CRISPR-based approaches targeting endogenous 3β-HSD to assess the consequences of reduced neurosteroid synthesis on disease progression.

    • Create conditional knockout models with brain region-specific deletion to identify critical sites of neurosteroidogenesis.

  • Biomarker Development:

    • Utilize recombinant enzyme assays to identify disease-specific alterations in 3β-HSD activity that could serve as diagnostic markers.

    • Develop high-throughput screening methods to detect serum or CSF metabolites that reflect altered 3β-HSD function in neurodegeneration.

    • Correlate enzyme activity measures with clinical disease severity and progression.

  • Therapeutic Target Validation:

    • Screen compound libraries for selective modulators (activators or inhibitors) of 3β-HSD type 2 that could normalize altered neurosteroid profiles.

    • Test identified compounds in cellular and animal models of neurodegeneration to assess their effects on disease hallmarks.

    • Evaluate the pharmacokinetics and brain penetration of promising compounds targeting the enzyme .

By implementing these approaches, researchers can better understand the complex role of neurosteroid metabolism in neurodegenerative processes and potentially identify novel therapeutic strategies targeting 3β-HSD-mediated pathways.

What methodologies are most effective for studying interactions between recombinant rat 3β-HSD type 2 and other steroidogenic enzymes?

Investigating interactions between recombinant rat 3β-HSD type 2 and other steroidogenic enzymes requires sophisticated methodologies that can capture both physical interactions and functional coupling:

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation using antibodies against 3β-HSD type 2 to pull down interacting partners from steroidogenic tissues or cells.

    • Proximity ligation assays (PLA) to visualize interactions in situ within cells at sub-cellular resolution.

    • FRET/BRET approaches using fluorescently tagged enzymes to monitor real-time interactions in living cells.

    • Cross-linking mass spectrometry to map interaction interfaces at the amino acid level.

  • Multi-Enzyme Functional Assays:

    • Reconstitution experiments with purified recombinant enzymes to detect synergistic or inhibitory effects on steroid conversion.

    • Sequential enzyme reactions in microfluidic systems that allow precise control of substrate delivery and product removal.

    • Metabolic flux analysis using isotope-labeled precursors to trace multi-enzyme pathways.

    • Kinetic modeling of coupled enzyme reactions to identify rate-limiting steps and regulatory nodes.

  • Subcellular Colocalization Studies:

    • Super-resolution microscopy (STORM, PALM) to visualize enzyme clustering at nanometer resolution.

    • Subcellular fractionation followed by activity assays to identify compartment-specific interactions.

    • Electron microscopy with immunogold labeling to precisely localize multiple enzymes within cellular ultrastructure.

    • Live-cell imaging with differentially tagged enzymes to track dynamic associations during steroidogenesis.

  • System Integration Analysis:

    • Co-expression studies varying the relative expression levels of 3β-HSD type 2 and potential partner enzymes.

    • Mathematical modeling of steroidogenic networks to predict the functional consequences of enzyme-enzyme interactions.

    • Perturbation experiments using selective inhibitors to dissect the contribution of each enzyme to the integrated pathway.

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics to capture the full complexity of steroidogenic networks .

These methodologies, used in combination, provide a comprehensive view of how 3β-HSD type 2 functions within the broader context of steroidogenic enzyme complexes and metabolic pathways.

How can structural biology approaches be applied to understand the catalytic mechanism of rat 3β-HSD type 2?

Structural biology offers powerful approaches to elucidate the catalytic mechanism of rat 3β-HSD type 2, providing insights at the atomic level:

  • Protein Crystallography and Cryo-EM:

    • Generate purified, homogeneous recombinant protein suitable for crystallization trials.

    • Employ membrane protein-specific crystallization techniques (lipidic cubic phase, bicelles) to accommodate the membrane-associated nature of the enzyme.

    • Capture multiple catalytic states by co-crystallizing with substrates, products, cofactors, or transition state analogs.

    • Use cryo-electron microscopy as an alternative approach for structural determination if crystallization proves challenging.

    • Analyze electron density maps to identify the positions of catalytic residues, substrate binding pockets, and cofactor interaction sites.

  • Computational Structural Analysis:

    • Perform molecular dynamics simulations to model conformational changes during the catalytic cycle.

    • Use quantum mechanics/molecular mechanics (QM/MM) calculations to model the electronic structure of the active site during catalysis.

    • Apply homology modeling based on related proteins with known structures to predict structural features.

    • Conduct docking studies with various substrates to understand substrate specificity determinants.

  • Structure-Guided Mutagenesis:

    • Design site-directed mutagenesis experiments targeting predicted catalytic residues, substrate binding sites, and cofactor interaction regions.

    • Generate mutant proteins with substitutions at key positions (e.g., changing polar residues to alanine or introducing conservative substitutions).

    • Perform comprehensive kinetic analysis of mutants to correlate structural features with specific aspects of catalysis.

    • Use the resulting structure-function relationships to refine mechanistic models.

  • Biophysical Characterization:

    • Employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with altered solvent accessibility during catalysis.

    • Apply nuclear magnetic resonance (NMR) to study protein dynamics and ligand interactions in solution.

    • Utilize circular dichroism spectroscopy to monitor secondary structure changes upon substrate or cofactor binding.

    • Use isothermal titration calorimetry (ITC) to determine thermodynamic parameters of substrate and cofactor binding .

Through the integration of these structural biology approaches, researchers can develop a comprehensive understanding of how rat 3β-HSD type 2 achieves its dual dehydrogenase and isomerase activities, providing foundation for rational design of isoform-specific modulators.

What are common pitfalls in recombinant rat 3β-HSD type 2 expression and activity assays, and how can they be addressed?

Researchers working with recombinant rat 3β-HSD type 2 frequently encounter several challenges that can compromise experimental outcomes. Here are the most common pitfalls and their solutions:

  • Low Expression Levels:

    • Pitfall: Poor protein yield despite successful transfection.

    • Solutions:

      • Optimize codon usage for the host cell system.

      • Include a Kozak consensus sequence before the start codon.

      • Test different promoters (CMV, EF1α) to identify optimal expression control.

      • Consider using expression enhancers like sodium butyrate (1-5 mM) in culture medium.

  • Enzyme Inactivation During Purification:

    • Pitfall: Loss of activity during extraction and purification.

    • Solutions:

      • Maintain reducing conditions throughout (1-5 mM DTT or β-mercaptoethanol).

      • Include glycerol (20%) and cofactor (NAD+, 0.5 mM) in all buffers.

      • Use mild detergents (CHAPS, digitonin) for solubilization.

      • Perform all procedures at 4°C and minimize time between steps.

  • Inconsistent Activity Measurements:

    • Pitfall: High variability between assays or preparations.

    • Solutions:

      • Standardize substrate and cofactor concentrations across experiments.

      • Establish internal controls with known activity for normalization.

      • Ensure consistent NAD+/NADPH ratios in reactions.

      • Prepare larger batches of enzyme preparations for extended experimental series.

  • Background Activity in Host Cells:

    • Pitfall: Endogenous enzymes in host cells contribute to measured activities.

    • Solutions:

      • Include empty vector controls in all experiments.

      • Select host cells with minimal endogenous steroidogenic activity.

      • Use isoform-specific inhibitors to differentiate between endogenous and recombinant activities.

      • Consider siRNA knockdown of endogenous enzymes in host cells.

  • Substrate Solubility Issues:

    • Pitfall: Poor substrate dissolution leading to inconsistent reaction conditions.

    • Solutions:

      • Prepare concentrated stock solutions in ethanol or DMSO (keep final solvent concentration below 1%).

      • Use β-cyclodextrin (0.1-0.5%) as a carrier to improve steroid solubility.

      • Sonicate substrate solutions briefly before adding to reactions.

      • Verify actual substrate concentrations by HPLC or UV spectroscopy .

By anticipating these common pitfalls and implementing the suggested solutions, researchers can significantly improve the reliability and reproducibility of experiments with recombinant rat 3β-HSD type 2.

How can researchers validate the specificity and reliability of antibodies used for detecting recombinant rat 3β-HSD type 2?

Validating antibodies for specific detection of recombinant rat 3β-HSD type 2 is critical for reliable experimental outcomes. A comprehensive validation approach should include:

  • Positive and Negative Control Testing:

    • Test antibodies against cells/tissues with verified expression of 3β-HSD type 2 (positive control).

    • Use tissues from knockout models or cells without expression as negative controls.

    • Compare reactivity between type 2-transfected cells and empty vector-transfected cells.

    • Include related isoforms (types I, III, IV) to assess cross-reactivity.

  • Multiple Detection Methods Comparison:

    • Perform parallel validations using Western blotting, immunohistochemistry, and immunofluorescence.

    • Verify that the antibody detects a single band of appropriate molecular weight (42 kDa) in Western blots.

    • Confirm that cellular localization patterns match expected distribution (ER and mitochondrial membranes).

    • Compare results using multiple antibodies targeting different epitopes of the same protein.

  • Validation by Molecular Techniques:

    • Correlate antibody signal intensity with mRNA levels measured by RT-qPCR.

    • Perform siRNA knockdown of the enzyme and verify corresponding reduction in antibody signal.

    • Use epitope-tagged recombinant protein and compare detection between anti-tag and anti-3β-HSD antibodies.

    • Demonstrate antibody recognition of purified recombinant protein.

  • Peptide Competition Assays:

    • Pre-incubate antibody with excess immunizing peptide (if available).

    • Verify abolishment of specific signal in all detection methods.

    • Use peptides corresponding to other isoforms to assess epitope specificity.

  • Mass Spectrometry Confirmation:

    • Immunoprecipitate the protein using the antibody.

    • Verify the identity of the precipitated protein by mass spectrometry.

    • Confirm that peptides specific to type 2 (and not other isoforms) are detected.

  • Cross-Species Reactivity Assessment:

    • Test antibody against 3β-HSD from other species if sequence similarity is known.

    • Document species cross-reactivity for future reference.

    • Use this information to design appropriate controls for experiments using tissues from different species .

These validation steps should be systematically documented and reported when publishing research using these antibodies, enhancing reproducibility and reliability of the findings.

What strategies can help researchers distinguish between the activities of endogenous and recombinant 3β-HSD in experimental systems?

Distinguishing between endogenous and recombinant 3β-HSD activities presents a significant challenge in many experimental systems. Researchers can implement the following strategies to address this issue:

  • Epitope Tagging and Selective Immunoprecipitation:

    • Express recombinant rat 3β-HSD type 2 with an epitope tag (FLAG, HA, or His).

    • Use tag-specific antibodies to selectively immunoprecipitate the recombinant enzyme.

    • Perform activity assays on the immunoprecipitated material to measure recombinant enzyme activity specifically.

    • Compare activity in immunoprecipitates from tagged enzyme versus empty vector controls.

  • Selective Inhibition Approaches:

    • Identify isoform-selective inhibitors that differentially affect type 2 versus other isoforms.

    • Conduct parallel activity assays with and without these inhibitors.

    • Calculate the inhibitor-sensitive component attributable to the specific isoform.

    • Use concentration-response curves to separate activities based on differential inhibitor sensitivity.

  • Genetic Modification of Host Systems:

    • Select host cells with minimal endogenous 3β-HSD activity.

    • Use CRISPR/Cas9 to knock out endogenous 3β-HSD in host cells before transfection.

    • Create cell lines with inducible expression systems where recombinant activity can be switched on and off.

    • Compare activities before and after induction to quantify the recombinant component.

  • Substrate Specificity Exploitation:

    • Identify substrates preferentially metabolized by rat 3β-HSD type 2 versus endogenous isoforms.

    • Design assays using these selective substrates to highlight recombinant activity.

    • Analyze product formation patterns that might differ between isoforms.

    • Use species-specific substrate preferences if host cells are from a different species.

  • Kinetic Parameter Differentiation:

    • Determine Km and Vmax values for both endogenous and recombinant enzymes.

    • Design assays at substrate concentrations that maximize the contribution of one activity over the other.

    • Apply two-component kinetic models to mathematically separate the contributions.

    • Use double-reciprocal plots to identify the presence of multiple enzyme activities .

By implementing a combination of these strategies, researchers can effectively distinguish between endogenous and recombinant 3β-HSD activities, leading to more accurate characterization of the recombinant rat 3β-HSD type 2 enzyme properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.