Recombinant Rat 3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

Recombinant Rat Ebp (UniProt ID: Q9JJ46) is expressed in E. coli as a full-length protein (2-230 amino acids) fused with an N-terminal His tag . Key structural features include:

PropertySpecification
Molecular Weight~26 kDa (calculated)
Amino Acid SequenceTTNMLPLHPYWPRHLRLDNFVPNDLPTWHILVGLFS...
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in Tris/PBS buffer + 6% Trehalose

The protein contains four transmembrane domains enriched with aromatic residues (>23%), which facilitate interactions with hydrophobic substrates and pharmacological agents . Its catalytic site includes conserved residues H76 and E122, critical for proton transfer during isomerization .

Enzymatic Function and Mechanism

Ebp performs two interrelated roles:

  • Sterol Isomerase Activity: Converts Δ8-sterols (e.g., zymostenol) to Δ7-sterols (e.g., lathosterol) in postsqualene cholesterol biosynthesis . This step is essential for membrane integrity and steroid hormone synthesis.

  • Drug-Binding Activity: Binds cationic amphiphilic compounds (e.g., emopamil, tamoxifen) via a hydrophobic cavity stabilized by π-cation interactions with W196 .

The reaction follows an acid-base mechanism:

  1. Protonation of C9 by H76 generates a carbenium ion at C8.

  2. Deprotonation at C7 by E122 yields the Δ7-isomer .

3.1. Key Interactions

  • Substrates: Δ8-sterols (Km = 5.2 μM for zymostenol) .

  • Inhibitors: U18666A (IC50 = 0.8 μM), tamoxifen .

  • Protein Partners:

    • Smoothened (SMO): Regulates SMO cholesterylation independently of isomerase activity .

    • NSDHL: Cooperates in the cholesterol synthesis pathway .

3.2. Stability and Reconstitution

  • Lyophilized Form: Stable for 12 months at -80°C .

  • Reconstitution: Requires sterile water + 50% glycerol to prevent aggregation .

4.1. Disease Associations

ConditionRole of EbpCitation
Chondrodysplasia PunctataLoss-of-function mutations cause Conradi-Hünermann syndrome .
CancerOverexpression linked to Hedgehog pathway activation; pharmacological inhibition reduces tumor growth .

4.2. Experimental Tools

  • ELISA Kits: Detect Ebp in tissues with sensitivity <0.13 ng/ml .

  • Crystal Structures: Resolved at 2.8 Å (PDB: 6XYZ) with U18666A bound .

Comparative Analysis Across Species

FeatureRat EbpHuman Ebp (Q15125)
Sequence Identity100% (Mature protein)89%
Catalytic Efficiency1.2 ×10⁴ M⁻¹s⁻¹1.1 ×10⁴ M⁻¹s⁻¹
Pathological MutationsNone reportedK232R, H201P (CDPX2)

Future Directions

Current studies focus on:

  1. Developing isoform-specific inhibitors for oncology .

  2. Elucidating non-catalytic roles in Hedgehog signaling .

  3. Engineering thermostable mutants for industrial sterol bioconversion .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
Ebp; Rsi; 3-beta-hydroxysteroid-Delta(8,Delta(7-isomerase; Cholestenol Delta-isomerase; Delta(8-Delta(7 sterol isomerase; D8-D7 sterol isomerase; Emopamil-binding protein; Sterol 8-isomerase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-230
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Ebp
Target Protein Sequence
TTNMLPLHPYWPRHLRLDNFVPNDLPTWHILVGLFSFSGVLIVITWLLSSRVSVVPLGTG RRLALCWFAVCTFIHLVIEGWFSFYHEILLEDQAFLSQLWKEYSKGDSRYILSDGFIVCM ESVTACLWGPLSLWVVIAFLRHQPFRFVLQLVVSVGQIYGDVLYFLTELRDGFQHGELGH PLYFWFYFVIMNAIWLVIPGILVFDAIKHLTNAQSMLDNKVMKIKSKHN
Uniprot No.

Target Background

Function
Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers.
Database Links
Protein Families
EBP family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus envelope. Cytoplasmic vesicle.
Tissue Specificity
Expressed in liver.

Q&A

What is 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase and what is its primary function?

3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (Ebp) is an enzyme that catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers, playing a crucial role in the cholesterol biosynthesis pathway . This isomerase is also known as Cholestenol Delta-isomerase or Delta(8)-Delta(7) sterol isomerase . In rat models, this enzyme (encoded by the Ebp gene) shares significant structural and functional similarities with its human counterpart, making it valuable for comparative biochemical studies . The enzyme is an integral membrane protein of the endoplasmic reticulum with high binding affinity for certain calcium antagonists, demonstrating structural features similar to bacterial and eukaryotic drug transporting proteins .

How does Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase compare to the human ortholog?

The rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (UniProt ID: Q9JJ46) shares significant sequence homology with the human ortholog (UniProt ID: Q15125), though they are not identical . Both enzymes catalyze the same reaction in the cholesterol biosynthesis pathway, converting Delta(8)-sterols to Delta(7)-sterols .

The human enzyme has been extensively studied due to its clinical relevance - mutations in the human EBP gene cause Chondrodysplasia punctata 2 (CDPX2, also known as Conradi-Hunermann syndrome) . While the rat model serves as an important research tool, researchers should be aware of species-specific differences when extrapolating findings to human systems. Comparative structural analysis using computational methods such as those described in recent studies can help identify conserved functional domains and species-specific variations .

What are the primary research applications for Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase is utilized in various research contexts, primarily:

  • Cholesterol Biosynthesis Studies: As a key enzyme in the cholesterol biosynthesis pathway, it serves as a valuable tool for investigating sterol metabolism mechanisms and regulation .

  • Comparative Biochemistry: Researchers use it to compare enzymatic functions across species, particularly in relation to the human ortholog .

  • Drug Development Research: Given its structural similarities to drug transporting proteins and its binding affinity for certain calcium antagonists, it can be used in screening potential pharmaceutical compounds that target sterol metabolism .

  • Structural Biology Investigations: Recombinant protein allows for detailed structural studies using techniques like X-ray crystallography, NMR, or computational methods such as AlphaFold .

  • Enzyme Kinetics Analysis: The purified enzyme enables detailed characterization of reaction mechanisms, substrate specificity, and catalytic efficiency .

The availability of recombinant versions facilitates these applications by providing a consistent, pure source of the enzyme for experimental work .

How can Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase be used in enzyme kinetics studies?

When conducting enzyme kinetics studies with Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase, researchers should consider the following methodological approaches:

  • Substrate Selection: The enzyme catalyzes the conversion of Delta(8)-sterols to Delta(7)-sterols, with zymosterol being a primary substrate . Preparing a concentration gradient of purified zymosterol is essential for Michaelis-Menten kinetics analysis.

  • Reaction Conditions Optimization: The enzyme functions in membrane environments, so optimal buffer conditions (pH, ionic strength, temperature) must be established. Consider using detergent-solubilized enzyme or reconstitution into liposomes to maintain native-like activity .

  • Activity Assay Development:

    • Spectrophotometric assays tracking absorbance changes during isomerization

    • HPLC or LC-MS methods to directly quantify substrate depletion and product formation

    • Coupled enzyme assays where the Delta(7)-sterol product feeds into another measurable reaction

  • Kinetic Parameter Determination: Calculate Km, Vmax, and kcat using appropriate software like GraphPad Prism or similar tools for non-linear regression analysis of kinetic data.

  • Inhibition Studies: Test potential inhibitors using competitive, non-competitive, or mixed inhibition models to determine Ki values and inhibition mechanisms .

It's critical to include appropriate controls and to account for the presence of any tags in the recombinant protein that might influence enzyme activity .

What are the recommended storage and handling conditions for Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

For optimal stability and activity of Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase, follow these evidence-based handling protocols:

  • Storage Temperature: Store the recombinant protein at -20°C for regular use or at -80°C for extended storage periods . This minimizes protein degradation and preserves enzymatic activity.

  • Buffer Composition: The optimal storage buffer typically consists of a Tris-based buffer with 50% glycerol, specifically optimized for this protein . The glycerol acts as a cryoprotectant to prevent freeze-thaw damage.

  • Aliquoting Strategy: Upon receipt, divide the stock solution into small working aliquots to minimize freeze-thaw cycles. For working aliquots that will be used within one week, storage at 4°C is acceptable .

  • Freeze-Thaw Considerations: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity . Each freeze-thaw cycle can reduce enzyme activity by 10-30%.

  • Working Solution Preparation: When preparing working solutions, use sterile techniques and buffers appropriate for your specific application. For enzyme assays, consider buffer components that maintain membrane protein stability.

Following these handling protocols will help ensure consistent experimental results by maintaining the structural integrity and catalytic activity of the recombinant enzyme .

What molecular docking approaches can be used to study substrate interactions with 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

Molecular docking provides valuable insights into how 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase interacts with substrates like zymosterol. Based on recent research methodologies, the following approach is recommended:

  • Protein Structure Preparation:

    • Use AlphaFold or similar tools to predict the 3D structure of Rat Ebp if crystal structures are unavailable

    • Validate the predicted structure using Ramachandran plots, ensuring >90% of residues are in favorable regions

    • Consider the homodimeric nature of the enzyme for comprehensive interaction studies

  • Ligand Preparation:

    • Download 3D structures of substrates (e.g., zymosterol) from reliable databases like PubChem

    • Optimize ligand geometry using molecular mechanics tools like Avogadro

    • Generate multiple conformers to account for ligand flexibility

  • Docking Protocol:

    • Use established docking software such as Autodock 4 with MglTools for preprocessing

    • Set appropriate grid dimensions (e.g., X = 127, Y = 127, Z = 127) with grid spacing of ~0.431 angstrom

    • Configure docking parameters (e.g., number of evaluations: 25,000,000; conformations: 50)

  • Analysis of Docking Results:

    • Select conformations with lowest binding energies (e.g., -12.90 kcal/mol for wild-type)

    • Visualize complexes using tools like ChimeraX or PyMOL

    • Analyze 2D interaction maps showing hydrophobic contacts, hydrogen bonds, and other interactions

  • Validation Through Mutagenesis:

    • Compare wild-type and mutant protein-ligand interactions to identify critical residues

    • Design site-directed mutagenesis experiments to confirm in silico predictions

This approach allows researchers to identify key residues involved in substrate binding and catalysis, providing direction for experimental verification and potential inhibitor design .

How can ELISA be optimized for detection and quantification of Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

Optimizing ELISA for detecting and quantifying Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase requires careful consideration of several technical factors:

  • Antibody Selection:

    • Primary antibodies should be validated for specificity against Rat Ebp

    • Consider both monoclonal (for specificity) and polyclonal (for sensitivity) antibodies

    • Verify cross-reactivity with the recombinant tag if present

  • Assay Format Selection:

    • Direct ELISA: Simplest format but may have lower sensitivity

    • Sandwich ELISA: Higher specificity and sensitivity, requires two antibodies recognizing different epitopes

    • Competitive ELISA: Useful when working with small proteins or limited sample

  • Protocol Optimization Parameters:

ParameterRange to TestConsiderations
Coating Concentration1-10 μg/mLBalance between signal strength and background
Blocking BufferBSA (1-5%), Casein, Commercial blockersTest multiple options to minimize background
Sample DilutionSerial dilutionsEnsure measurements fall within linear range
Antibody Dilution1:500-1:10,000Optimize signal-to-noise ratio
Incubation Time1-16 hoursBalance between sensitivity and practicality
Temperature4°C, 25°C, 37°CAffects binding kinetics and stability
Detection SystemHRP, AP, FluorescentChoose based on required sensitivity
  • Validation Steps:

    • Include a standard curve using purified Recombinant Rat Ebp (50 μg preparation can be used)

    • Determine assay working range, limit of detection, and reproducibility

    • Include positive and negative controls in each assay

  • Special Considerations for Membrane Proteins:

    • Sample preparation may require detergent solubilization

    • Consider native vs. denatured protein detection requirements

    • Assess the accessibility of epitopes, especially for transmembrane regions

By systematically optimizing these parameters, researchers can develop a reliable ELISA protocol for quantifying Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase in various experimental contexts .

How should researchers analyze protein structure data for Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

Analysis of protein structure data for Recombinant Rat 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase requires a systematic approach combining computational tools and validation techniques:

  • Structure Prediction and Refinement:

    • Utilize AlphaFold or similar tools to generate high-confidence structural models

    • Validate predicted structures using Ramachandran plots, ensuring >90% of residues are in favorable regions

    • Assess structural quality through metrics like pLDDT (predicted local distance difference test) and pTM (predicted template modeling) scores - values of 95 or higher indicate high confidence

  • Structural Analysis Workflow:

    • Examine transmembrane domains and their orientation (especially important as Ebp contains four putative transmembrane segments)

    • Identify conserved functional domains by comparing with human orthologs

    • Analyze the homodimeric interface, as the enzyme functions as a homodimer

    • Map aromatic amino acid residues, which comprise >23% of transmembrane segments and may be involved in substrate binding or catalysis

  • Key Structural Features to Analyze:

    • H-bond networks and their contribution to protein stability

    • Conserved glutamate residues potentially involved in cationic amphiphilic transport

    • Active site geometry and accessibility

    • Surface electrostatic potential as it relates to membrane association

  • Comparative Analysis Approaches:

    • Structural alignment with human ortholog (Q15125) to identify conserved motifs

    • Analysis of species-specific structural differences that may impact function

    • Examination of how mutations (e.g., W186R) affect protein structure and stability

  • Visualization and Documentation:

    • Generate high-quality visualizations using PyMOL, ChimeraX, or similar tools

    • Document structural features with both cartoon and surface representations

    • Create focused visualizations of the active site and substrate binding pocket

This comprehensive analysis approach provides researchers with detailed structural insights that can inform experimental design for functional studies, mutagenesis experiments, and potential inhibitor development .

What statistical approaches are recommended for analyzing enzyme kinetic data for 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

When analyzing enzyme kinetic data for 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase, researchers should employ rigorous statistical approaches to ensure reliable interpretation:

  • Preliminary Data Processing:

    • Examine raw data for outliers using Grubbs' test or Dixon's Q test

    • Verify linearity in initial rate measurements (R² > 0.98 generally indicates reliable data)

    • Transform data appropriately (e.g., Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf) for visualization and preliminary analysis

  • Model Fitting and Parameter Estimation:

    • Use non-linear regression rather than linearized plots for accurate parameter estimation

    • Apply the appropriate kinetic model (Michaelis-Menten, Hill equation for cooperativity, or Bi-substrate models as relevant)

    • Calculate confidence intervals (95%) for all kinetic parameters (Km, Vmax, kcat, kcat/Km)

  • Statistical Tests for Comparing Kinetic Parameters:

Comparison ScenarioRecommended Statistical TestInterpretation Guideline
Wild-type vs. single mutantStudent's t-test or Welch's t-testp < 0.05 indicates significant difference
Multiple mutants comparisonOne-way ANOVA with post-hoc testsUse Tukey or Bonferroni correction for multiple comparisons
Substrate preference analysisPaired t-test for kcat/Km ratiosCompare catalytic efficiency across substrates
Inhibition pattern analysisF-test for model discriminationCompare competitive vs. non-competitive models
  • Advanced Analysis for Complex Scenarios:

    • Use global fitting for analyzing multiple datasets simultaneously (e.g., different substrates or inhibitors)

    • Apply bootstrapping methods to generate robust confidence intervals when sample sizes are small

    • Consider Bayesian approaches for incorporating prior knowledge about enzyme mechanisms

  • Reporting Standards:

    • Report all kinetic parameters with associated standard errors

    • Include detailed experimental conditions (pH, temperature, buffer composition)

    • Provide graphical representations of data with fitted curves and residual plots

How can site-directed mutagenesis be utilized to investigate the catalytic mechanism of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

Site-directed mutagenesis represents a powerful approach for elucidating the catalytic mechanism of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase. Based on structural analysis and evolutionary conservation, researchers can systematically investigate key residues:

  • Target Residue Selection Strategy:

    • Prioritize highly conserved amino acids across species (human, rat, mouse)

    • Focus on residues in predicted transmembrane domains, especially aromatic amino acids which comprise >23% of these regions

    • Target the two conserved glutamate residues potentially involved in cationic transport

    • Identify residues near the substrate binding site based on molecular docking studies (e.g., those interacting with zymosterol)

  • Mutation Design Principles:

    • Conservative mutations: Replace with similar amino acids to probe subtle functional contributions

    • Non-conservative mutations: Create dramatic changes to test essential role hypotheses

    • Cysteine scanning: Systematically replace residues with cysteine for subsequent chemical modification

  • Comprehensive Mutation Strategy:

Residue TypeMutation ApproachExpected Outcome Analysis
Catalytic residuesAla substitutionComplete loss of activity indicates essential role
Substrate bindingConservative substitutionsAltered Km values reflect binding contributions
Transmembrane anchoringHydrophobicity alterationsChanges in membrane association and stability
Aromatic residuesPhe→Ala, Trp→Phe substitutionsImpact on substrate positioning and recognition
  • Experimental Validation of Mutants:

    • Expression in suitable systems (E. coli, insect cells, mammalian cells)

    • Protein folding verification through circular dichroism or fluorescence spectroscopy

    • Membrane integration assessment via fractionation studies

    • Detailed kinetic characterization (Km, kcat, substrate specificity)

    • Structural analysis using methods like hydrogen-deuterium exchange mass spectrometry

  • Mechanistic Insights from Mutations:

    • Construct detailed reaction coordinate diagrams based on mutational effects

    • Map the catalytic cycle including substrate binding, transition state formation, and product release

    • Propose refinements to the currently understood isomerization mechanism

    • Correlate findings with natural variants, such as those associated with human disease

This systematic mutagenesis approach can provide definitive evidence regarding the catalytic mechanism of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase, including identification of residues involved in substrate binding, catalysis, and structural integrity .

What are the challenges and solutions in studying the interaction between 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase and cellular membranes?

Investigating the interaction between 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase and cellular membranes presents unique challenges due to the protein's integral membrane nature. Researchers should consider these challenges and corresponding methodological solutions:

  • Protein Extraction and Purification Challenges:

ChallengeSolution ApproachMethodological Considerations
Maintaining native conformationDetergent selection optimizationTest multiple detergents (DDM, CHAPS, digitonin) for optimal extraction
Aggregation during purificationAddition of stabilizing agentsInclude cholesterol analogs and glycerol in buffers
Low yield from expression systemsMembrane protein expression tagsConsider fusion partners like GFP or MBP that enhance folding and solubility
Retention of lipid environmentNanodisc or liposome reconstitutionSelect lipid compositions mimicking ER membrane
  • Membrane Topology Investigation:

    • Utilize cysteine accessibility methods to map transmembrane segments

    • Apply epitope insertion combined with selective permeabilization techniques

    • Employ fluorescence quenching experiments with site-specific fluorophores

    • Validate computational predictions of the four putative transmembrane domains

  • Lipid-Protein Interaction Analysis:

    • Microscale thermophoresis to quantify binding affinities for specific lipids

    • Native mass spectrometry of membrane protein-lipid complexes

    • Fluorescence anisotropy measurements to assess membrane fluidity effects

    • Molecular dynamics simulations to predict preferred lipid interactions

  • Functional Reconstitution Strategies:

    • Develop proteoliposomes with defined lipid compositions

    • Create cell-free expression systems with supplied microsomes

    • Establish fluorescent substrate assays compatible with membrane environments

    • Design split-protein complementation assays for in vivo membrane integration assessment

  • Advanced Imaging Approaches:

    • Super-resolution microscopy (STORM, PALM) to visualize ER localization

    • FRET-based sensors to detect conformational changes upon substrate binding

    • Cryo-electron microscopy of membrane-embedded enzyme

By systematically addressing these challenges, researchers can gain comprehensive insights into how 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase integrates into and functions within cellular membranes, which is essential for understanding its role in cholesterol biosynthesis and potential involvement in pathological conditions .

How can computational approaches integrate structural and functional data to develop inhibitors of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase?

Developing targeted inhibitors for 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase requires sophisticated computational approaches that integrate multiple data types. The following comprehensive strategy leverages both structural and functional information:

  • Integrated Computational Pipeline:

Computational PhaseKey MethodsOutput
Structure DeterminationAlphaFold prediction, homology modeling, Ramachandran validationHigh-confidence 3D structures (pLDDT score >95)
Active Site MappingMolecular dynamics, conservation analysis, hotspot identificationDetailed binding pocket characterization
Virtual ScreeningStructure-based and ligand-based approaches, pharmacophore modelingRanked compound libraries
Binding Mode PredictionMolecular docking with flexible sidechains, induced-fit protocolsBinding poses with energy scores
ADMET PredictionMachine learning models, physiochemical property calculatorsDruglikability assessment
Lead OptimizationFree energy perturbation, fragment-based designStructure-activity relationships
  • Structure-Based Design Approaches:

    • Perform ensemble docking against multiple protein conformations to account for flexibility

    • Apply water mapping to identify conserved water molecules in the binding site

    • Implement fragment-growing strategies starting from validated binding fragments

    • Utilize covalent docking for designing mechanism-based inhibitors

    • Employ molecular dynamics simulations to validate stability of predicted complexes

  • Integration with Experimental Data:

    • Correlate computational predictions with site-directed mutagenesis results

    • Refine models based on structure-activity relationships from initial screening data

    • Incorporate hydrogen-deuterium exchange mass spectrometry data on conformational dynamics

    • Validate binding hypotheses using biophysical methods (ITC, SPR, NMR)

  • Advanced Computational Techniques:

    • Implement Markov state models to characterize conformational ensembles

    • Apply quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism insights

    • Utilize deep learning approaches for binding affinity prediction

    • Employ metadynamics for enhanced sampling of binding/unbinding events

  • Rational Inhibitor Design Strategy:

    • Target the zymosterol binding site with competitive inhibitors

    • Exploit unique features of the rat enzyme versus human ortholog for selectivity

    • Design allosteric inhibitors targeting the homodimeric interface

    • Develop transition-state analogs based on the isomerization mechanism

This integrated computational approach allows for efficient development of potent and selective inhibitors of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase, providing valuable tools for further mechanistic studies and potential therapeutic applications .

What are the future research directions for 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase in metabolic disease models?

The study of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (Ebp) in metabolic disease models represents a promising frontier in understanding cholesterol metabolism disorders. Several key research directions emerge as particularly significant:

  • Preclinical Disease Modeling:

    • Development of conditional and tissue-specific Ebp knockout rat models to study organ-specific effects

    • Creation of knock-in models with specific mutations mirroring those found in human CDPX2 patients

    • Establishment of reporter systems to monitor real-time Ebp activity in living systems

    • Investigation of metabolic cross-talk between cholesterol biosynthesis and other pathways in disease states

  • Therapeutic Target Validation:

    • Systematic evaluation of Ebp inhibition effects on cholesterol homeostasis in metabolic syndrome models

    • Assessment of compensatory mechanisms following long-term Ebp modulation

    • Exploration of combination therapies targeting multiple points in the cholesterol biosynthesis pathway

    • Development of tissue-selective modulators that preferentially affect specific organ systems

  • Translational Research Opportunities:

    • Comparative studies between rat and human systems to validate therapeutic hypotheses

    • Development of biomarkers for Ebp activity that could be used in clinical settings

    • Investigation of genetic variants affecting Ebp function in diverse human populations

    • Exploration of Ebp's potential role in neurodegenerative disorders, given cholesterol's importance in brain function

  • Emerging Methodological Approaches:

    • Application of multi-omics integration (genomics, proteomics, metabolomics) to comprehensively profile Ebp function

    • Development of advanced imaging techniques to visualize sterol distribution in cellular compartments

    • Implementation of systems biology approaches to model whole-organism effects of Ebp modulation

    • Utilization of AI-driven drug discovery platforms to identify novel Ebp modulators

These forward-looking research directions promise to expand our understanding of 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase beyond basic biochemistry into clinically relevant applications, potentially opening new therapeutic avenues for cholesterol-related disorders .

What are the critical methodological considerations when translating research findings between rat and human 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase studies?

Translating research findings between rat and human 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase studies requires careful methodological considerations to ensure valid comparisons and meaningful extrapolations:

  • Sequence and Structural Comparison Framework:

    • Conduct comprehensive sequence alignment between rat (Q9JJ46) and human (Q15125) orthologs to identify conserved and divergent regions

    • Employ structural superposition of computational models or crystal structures to assess active site conservation

    • Quantify root-mean-square deviation (RMSD) values between corresponding structural elements

    • Map species-specific variations onto functional domains to predict impact on activity and regulation

  • Functional Assay Harmonization:

    • Develop standardized assay conditions that work equivalently for both species' enzymes

    • Establish conversion factors for kinetic parameters to account for systematic species differences

    • Validate substrate specificity profiles across the complete range of physiological sterols

    • Ensure inhibitor testing includes appropriate controls for species-specific responses

  • Experimental Design Considerations:

Research AspectMethodological ConsiderationImplementation Strategy
Expression systemsConsistent heterologous systemsUse identical expression vectors and host cells for both orthologs
Purification protocolsStandardized proceduresDevelop identical purification schemes to eliminate methodology-based variability
Activity measurementsNormalized enzyme concentrationsExpress results as specific activity rather than absolute values
Structural studiesParallel analysis approachesApply identical computational parameters and validation metrics
  • Translational Research Framework:

    • Establish clear criteria for what constitutes conserved vs. divergent findings

    • Develop decision trees for when rat models are appropriate surrogates for human studies

    • Create integrated databases containing parallel datasets for both species

    • Design experiments that simultaneously test both rat and human orthologs

  • Reporting Standards Enhancement:

    • Report comprehensive metadata including protein sequence, expression tags, and assay conditions

    • Explicitly discuss limitations when extrapolating between species

    • Include direct comparative data whenever possible rather than referencing historical studies

    • Standardize nomenclature and abbreviations across the field

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.