Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (Srd5a1)

Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1, commonly referred to as Srd5a1, is a crucial enzyme involved in the metabolism of steroid hormones. This enzyme plays a pivotal role in converting testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids, which are essential for sexual differentiation and androgen physiology .

Function and Role of Srd5a1

Srd5a1 is a key enzyme in the steroid hormone metabolic pathway. It is primarily located in the microsome membrane and endoplasmic reticulum membrane, functioning as a multi-pass membrane protein . The enzyme's activity is central to male sex differentiation and the regulation of various physiological processes related to androgen hormones .

Recombinant Production of Srd5a1

The recombinant form of Srd5a1 is produced by expressing the full-length rat enzyme in Escherichia coli (E. coli). This recombinant protein is typically fused with an N-terminal His tag to facilitate purification and identification. The recombinant Srd5a1 protein consists of 259 amino acids and is available in a lyophilized powder form with a purity of greater than 90% as determined by SDS-PAGE .

Research Applications and Significance

The recombinant Srd5a1 protein is widely used in research applications, particularly in the field of steroid hormone metabolism. It serves as a valuable tool for studying the role of Srd5a1 in health and disease, facilitating insights into potential therapeutic interventions for conditions related to steroid hormone dysregulation . Additionally, ELISA kits are available for measuring Srd5a1 levels in rat samples, offering high sensitivity and specificity for precise and reproducible results .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Srd5a1; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; Steroid 5-alpha-reductase 1; S5AR 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Srd5a1
Target Protein Sequence
MVPLMELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQE LPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLA FLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGE TGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWY HEKFEDYPKSRKILIPFVL
Uniprot No.

Target Background

Function
Recombinant Rat 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (SRD5A1) catalyzes the conversion of testosterone to 5-alpha-dihydrotestosterone and the conversion of progesterone or corticosterone to their corresponding 5-alpha-3-oxosteroids. This enzyme plays a critical role in sexual differentiation and androgen physiology.
Gene References Into Functions
  1. Ziram inhibited SRD5A1 and AKR1C14 activities, potentially disrupting neurosteroid production in rats. PMID: 28707553
  2. Environmental enrichment in middle-aged rats increased mRNA levels of 5α-reductase-1, 3α-HSD, and cytochrome P450 17α-hydroxylase/c17,20-lyase, and decreased 5α-reductase-1 gene methylation. PMID: 26021641
  3. Low SRD5A1 expression is associated with benign prostatic hyperplasia. PMID: 23405234
  4. Environmental stress alters the expression of steroid 5α-reductase isoenzymes in the prostate. PMID: 23122426
  5. Testosterone levels during postnatal sexual differentiation influence adult brain 5α-reductase isozyme levels. PMID: 22131296
  6. Elevated 5α-reduced androgens in hyperinsulinemic conditions may result from insulin's stimulatory effect on 5α-reductase in granulosa cells. PMID: 20810561
  7. Vitamin E's regulation of SRD5A1 and GCLM in rat liver is not directly mediated by changes in promoter DNA methylation. PMID: 20447326
  8. 5α-R1 immunostaining is primarily observed in the white matter (WM). PMID: 15305365
  9. Significant sexual dimorphism exists in CNS 5α-reductase isozymes, suggesting a crucial role of dihydrotestosterone in CNS sexual dimorphism in females. PMID: 16595696
  10. Acute swim stress increases 5α-R isozymes in the prefrontal cortex of male rats. PMID: 17826869
  11. 5AR inhibitors exhibit antipsychotic-like effects, suggesting their potential as a novel therapeutic target for psychotic disorders. PMID: 18354385
Database Links

KEGG: rno:24950

STRING: 10116.ENSRNOP00000023659

UniGene: Rn.4620

Protein Families
Steroid 5-alpha reductase family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Liver and prostate (at a low level).

Q&A

What is the enzymatic function of Srd5a1 and how does it differ from other steroid reductase enzymes?

Srd5a1 (3-oxo-5-alpha-steroid 4-dehydrogenase 1) is a key enzyme that irreversibly converts testosterone into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. DHT exhibits approximately 10 times higher affinity to the androgen receptor than testosterone, making this conversion physiologically significant .

Unlike Srd5a2 (Type 2 isoform), which is predominantly expressed in reproductive organs, Srd5a1 is more widely distributed in non-reproductive tissues such as liver, skin, and brain regions . The differential tissue distribution underscores their distinct physiological roles, with Srd5a1 having broader functions beyond reproductive development.

What is the anatomical distribution of Srd5a1 in the rat brain?

Expression of Srd5a1 is widely distributed throughout the rodent brain, with highest expression in specific regions of the cerebral cortex, hippocampus, thalamus, hypothalamus, and amygdala . This widespread distribution suggests important neurophysiological functions.

Studies using radioactive in situ hybridization have mapped the discrete regions of Srd5a1 expression in mouse brain, revealing a complex and region-specific pattern. This distribution is particularly relevant for understanding the enzyme's role in neurosteroid biosynthesis, which affects neurotransmission through modulation of GABA receptors .

What are the optimal techniques for measuring Srd5a1 expression in rat tissue samples?

Several complementary techniques can be employed for comprehensive analysis of Srd5a1 expression:

  • RNA Protection Analysis: Protects a single 354-base RNA fragment in positive control tissues such as mouse liver, prostate, and hypothalamus, confirming specific Srd5a1 RNA transcript detection .

  • Radioactive in situ hybridization: Provides detailed spatial mapping of expression patterns in complex tissues like brain sections .

  • Quantitative PCR (qPCR): For studies requiring precise quantification, qPCR with appropriate reference genes (such as Cyclophilin and 18S rRNA) offers high sensitivity. Average Ct values for Srd5a1 in normal tissue typically range around 30-31, while in certain pathological conditions they may be lower (around 29) .

  • ELISA: Commercial rat Srd5a1 ELISA kits typically offer detection ranges of 0.156-10 ng/mL with sensitivities of 0.058-0.08 ng/mL, suitable for serum, plasma, tissue homogenates, and cell lysates .

  • Western blotting: For protein-level detection, using recombinant Srd5a1 (approximately 44 kDa) as a positive control ensures accurate identification .

How can researchers effectively generate loss-of-function models for Srd5a1?

Several approaches can be employed to study Srd5a1 loss-of-function:

  • Genetic knockout models: Null mutation mice (B6;129S7-Srd5a1tm1Mahe) have been generated by replacing the promoter region and 36 amino acids of the 3′ end of exon 1 with a neomycin resistance gene cassette .

  • RNA interference: Lentiviral shRNA targeting Srd5a1 has been successfully used to reduce expression to 10% of control levels, with knockdown efficiency confirmed at both transcript and protein levels .

  • Pharmacological inhibition: Dutasteride has been identified as an effective inhibitor of Srd5a1 and can be used at appropriate concentrations for reversible functional inhibition .

  • CRISPR-Cas9 gene editing: For targeted modifications of the Srd5a1 gene or its regulatory elements, particularly when studying specific polymorphisms or methylation status .

How does Srd5a1 expression change during alcohol dependence and withdrawal in rodent models?

Studies in Withdrawal Seizure-Prone (WSP) mice have yielded complex findings regarding Srd5a1 regulation during alcohol exposure:

These apparently contradictory findings highlight the complexity of Srd5a1 regulation in response to alcohol and suggest that post-transcriptional mechanisms may be involved in modulating enzyme activity during alcohol withdrawal.

What is the relationship between Srd5a1 and sex-specific ethanol consumption behaviors?

Srd5a1 plays a critical role in synthesizing neuroactive steroids that modulate ethanol consumption, with notable sex differences:

  • Under continuous access conditions, ethanol intake (6% and 10%) was significantly greater in female Srd5a1 knockout mice versus wildtype, but significantly lower in male knockout mice versus wildtype .

  • In 2-hour limited access sessions, Srd5a1 deletion retarded acquisition of 10% ethanol intake in female mice but facilitated it in males .

These findings demonstrate that Srd5a1-dependent mechanisms differentially regulate ethanol consumption in males and females, likely through altered neuroactive steroid synthesis affecting GABAA receptor function. This has important implications for understanding sex differences in alcohol use disorders and potential therapeutic approaches.

What is the expression profile of Srd5a1 in cancer tissues compared to normal tissues?

Multiple studies have demonstrated differential expression of Srd5a1 in various cancer types:

  • Non-small cell lung cancer (NSCLC): SRD5A1 is significantly overexpressed in NSCLC compared to normal adjacent tissue (NAT). Analysis of tumor samples from 23 patients showed average Ct values of 29.25 (±1.37) for SRD5A1 in tumors versus 30.74 (±0.97) in NAT .

  • Colorectal cancer (CRC): Immunohistochemical staining revealed significantly higher expression of SRD5A1 in CRC tissues compared to normal tissues. Western blot analysis confirmed elevated SRD5A1 protein levels in CRC cell lines compared to normal intestinal epithelial cells .

What are the molecular mechanisms by which Srd5a1 influences cancer progression?

In colorectal cancer, SRD5A1 appears to promote tumor progression through multiple mechanisms:

  • Cell viability and proliferation: Genetic knockdown of SRD5A1 significantly reduced cell viability of CRC cells (HCT116 and LOVO) in a time-dependent manner .

  • Cell cycle regulation: SRD5A1 inhibition triggered cell cycle arrest at the G2/M phase, with increased proportions of cells in this phase following knockdown .

  • Apoptosis inhibition: Flow cytometry analysis showed that attenuated expression of SRD5A1 resulted in higher levels of apoptosis in CRC cells .

  • Cellular senescence: SRD5A1 appears to function as a senescent suppressor in CRC, as SRD5A1-silenced cells showed higher proportions of SA-β-gal positive cells .

  • Migration promotion: Clinical results showed that SRD5A1 is closely related to lymph node metastasis and distant metastasis. CRC cell migration capacity was markedly weakened after SRD5A1 downregulation .

  • Signaling pathway modulation: SRD5A1 might regulate cell viability and migration through the nuclear factor-κB/vascular endothelial growth factor (NF-κB/VEGF) signaling pathway .

How is Srd5a1 expression regulated at the epigenetic level during development?

Srd5a1 is subject to complex tissue-specific epigenetic regulation:

In ovarian tissue:

  • Ovarian Srd5a1 mRNA increased 8-fold between postnatal days 10 and 30

  • Methylation of two specific CpGs in the first intron decreased up to 75% during this period

  • Estradiol (E2) exposure increases Srd5a1 expression in ovarian cells

  • Chromatin immunoprecipitation confirmed ESR1 binding to this differentially methylated genomic region and enrichment of the enhancer modification H3K4me1

  • Targeted dCas9-DNMT3 to this locus increased CpG2 methylation 2.5-fold and abolished the Srd5a1 response to E2

In hypothalamic tissue:

  • Srd5a1 mRNA levels decreased 70% between postnatal days 7 and 10 and then remained constant

  • This decrease did not correlate with CpG methylation levels

  • Srd5a1 mRNA levels did not respond to E2 in hypothalamic GT1-7 cells, even after dCas9-TET1 reduced CpG1 methylation by 50%

  • The neonatal drop in POA Srd5a1 expression occurs during rising glucocorticoid levels

  • Treatment of GT1-7 cells with dexamethasone reduced Srd5a1 mRNA levels

  • Chromatin immunoprecipitation confirmed glucocorticoid receptor binding at the enhancer

These findings demonstrate tissue-specific epigenetic regulation mechanisms for Srd5a1 and highlight the potential for targeted epigenetic editing in modulating Srd5a1 expression.

How do specific polymorphisms in the Srd5a1 gene affect its function in different physiological contexts?

Several polymorphisms in the Srd5a1 gene have been identified and studied for their potential physiological effects:

  • rs6884552 and rs3797177 in the SRD5A1 gene have been investigated in relation to metabolic parameters and anthropometric indicators .

  • Researchers have examined associations between these polymorphisms and BMI categories. For example, for the rs6884552 polymorphism in SRD5A1, the distribution in one study showed 32 (10.7%) CC genotype carriers in the BMI ≥25 category and 67 (22.4%) in the BMI 25-29.99 category .

Analysis of these polymorphisms typically involves PCR amplification followed by melting curve analysis. The research methodology typically includes:

  • DNA extraction from appropriate samples

  • PCR amplification using specific primers for the target polymorphisms

  • Melting curve generation by holding the reaction at specific temperatures (e.g., 40°C for 20s) and then heating slowly

  • Statistical analysis to verify genotype frequencies fit to the Hardy-Weinberg equilibrium

  • Assessment of associations between genotypes and relevant physiological parameters

What are the available research tools for recombinant Srd5a1 expression in experimental models?

Several research tools are available for Srd5a1 overexpression and functional studies:

  • Adeno-Associated Viral Vectors (AAV): AAV vectors expressing rat Srd5a1 are available for in vivo expression studies. These include:

    • Multiple serotypes: AAV1, AAV2, AAV3, AAV5, AAV6, AAV8, AAV9, AAV-DJ, AAV-DJ8, AAV-DJ9

    • Promoter options: CMV (default) or choice from 30 different ubiquitous or cell-specific promoters

    • Optional reporters: GFP, CFP, YFP, RFP or mCherry

    • Gene details: Rat Srd5a1 ORF size of 768 bp

  • Recombinant Proteins: Prokaryotically expressed recombinant rat Srd5a1 proteins are available with:

    • N-terminal His and GST Tag

    • Purity >95%

    • Accurate molecular mass of 44kDa

    • Applications including positive control, immunogen, SDS-PAGE, and Western blot

  • Detection Reagents: Various antibodies and ELISA kits specifically for rat Srd5a1:

    • ELISA kits with detection ranges of 0.156-10ng/mL and sensitivities around 0.08ng/mL

    • Suitable for serum, plasma, tissue homogenates, cell lysates, and other biological fluids

How can researchers effectively design experiments to study the interaction between Srd5a1 and steroid hormone signaling pathways?

To effectively study Srd5a1-steroid hormone interactions, consider the following experimental approaches:

  • Gene expression correlation studies:

    • Measure Srd5a1 expression alongside relevant steroid hormone receptors in target tissues

    • Use qPCR with appropriate reference genes (e.g., Cyclophilin, 18S rRNA)

    • Correlate expression patterns with physiological parameters

  • Hormone treatment experiments:

    • Expose relevant cell lines or tissues to specific hormones (e.g., estradiol, dexamethasone)

    • Monitor changes in Srd5a1 expression at both mRNA and protein levels

    • Examples include exposure of ovarian cells to estradiol increasing Srd5a1 expression, and treatment of GT1-7 cells with dexamethasone reducing Srd5a1 mRNA levels

  • Chromatin immunoprecipitation (ChIP):

    • Perform ChIP to identify hormone receptor binding to Srd5a1 regulatory regions

    • Studies have confirmed estrogen receptor (ESR1) binding to differentially methylated genomic regions of Srd5a1 and enrichment of enhancer modifications (H3K4me1)

    • Similarly, glucocorticoid receptor binding at the Srd5a1 enhancer has been demonstrated

  • Epigenetic manipulation:

    • Use targeted dCas9-DNMT3 to modify methylation status of specific CpGs in Srd5a1 regulatory regions

    • Examine how these modifications affect hormone responsiveness

    • For example, increasing CpG2 methylation 2.5-fold abolished the Srd5a1 response to estradiol in ovarian cells

  • Functional enzyme activity assays:

    • Measure the conversion of testosterone to DHT in the presence of recombinant Srd5a1

    • Test how various inhibitors affect this conversion

    • Examine downstream androgen receptor activation using reporter systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.