Recombinant Rat 5-hydroxytryptamine receptor 2C (Htr2c)

Shipped with Ice Packs
In Stock

Description

Production and Purification Methods

Recombinant rat Htr2c is produced via heterologous expression systems:

Host SystemMethodAdvantages
E. coliFull-length expression with N-terminal His tag High yield, cost-effective, rapid production
PurificationAffinity chromatography (Ni-NTA resin) High specificity for His-tagged proteins

Post-purification, the protein is lyophilized and stored at -20°C/-80°C to maintain stability .

Pathological Insights

  • Impulsivity and Stress: Low membrane Htr2c expression correlates with high impulsivity in rat models, while PSD95 association reduces receptor activity .

  • Hypothalamic-Pituitary-Adrenal (HPA) Axis: Htr2c RNA editing modulates corticosterone release and stress responses .

Functional Dysregulation in Neuropsychiatric Disorders

StudyFindingsSource
Impulsive BehaviorHI rats exhibit reduced Htr2c membrane expression and increased PSD95 binding, impairing receptor signaling .
HPA Axis ActivityMice lacking Htr2c RNA editing show hyperactive HPA axis and altered circadian rhythms .
RNA EditingUnedited Htr2c (INI) isoforms exhibit hyperactivity in vitro, but in vivo effects are cell-type specific .

Technological Applications

ApplicationDetailsSource
ELISA KitsSandwich ELISA (RTDL00515) quantifies Htr2c in rat tissues (0.312–20 ng/mL) .
Protein StandardsRecombinant Htr2c serves as a reference in Western blotting and affinity assays .

Challenges and Considerations

  • Post-Translational Modifications: E. coli-expressed Htr2c lacks glycosylation, potentially affecting membrane integration .

  • RNA Editing Complexity: In vitro studies may not fully replicate in vivo editing patterns, necessitating caution in interpreting results .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Htr2c; 5ht1c; Htr1c; 5-hydroxytryptamine receptor 2C; 5-HT-2C; 5-HT2C; 5-HTR2C; 5-hydroxytryptamine receptor 1C; 5-HT-1C; 5-HT1C; Serotonin receptor 2C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine receptor 2C (5-HT2CR) is a G-protein coupled receptor that binds 5-hydroxytryptamine (serotonin). It also serves as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI), and lysergic acid diethylamide (LSD). Ligand binding induces a conformational change, initiating signaling through guanine nucleotide-binding proteins (G proteins) and modulating downstream effector activity. Beta-arrestin family members inhibit G protein signaling and mediate alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system, influencing phosphatidylinositol 3-kinase activity, downstream cascades, and intracellular calcium release. The receptor regulates neuronal activity by activating transient receptor potential calcium channels in the brain, thereby modulating pro-opiomelacortin neuron activation and corticosterone release via corticotropin-releasing hormone (CRH). It plays a crucial role in regulating appetite, feeding behavior, responses to anxiogenic stimuli and stress, and influences insulin sensitivity and glucose homeostasis.
Gene References Into Functions
  1. A study demonstrated that intra-VTA injection of the selective 5-HT2CR agonist AR231630 inhibits amphetamine-induced and basal locomotor activity and food intake in rats. This anorexic effect is blocked by intra-VTA SB24208 (5-HT2CR antagonist) injection, highlighting the receptor's role in these processes. PMID: 29555337
  2. This research showed that 5-HT2CR-expressing striatal neurons constituted 23% (dorsolateral caudate-putamen), 37% (ventromedial caudate-putamen), 53% (nucleus accumbens-core), and 49% (nucleus accumbens-shell). PMID: 27252352
  3. Amygdala 5-HT2CR knockdown reduced neuronal activity and neuropathic pain-related behaviors. PMID: 28011743
  4. Studies indicated that during prolonged cocaine abstinence, incubation of cue reactivity is associated with reduced potency of the selective 5-HT2CR agonist WAY163909 in suppressing cue reactivity, without impacting agonist efficacy. PMID: 26926963
  5. Findings reveal a 5-hydroxytryptamine-mediated mechanism underlying susceptibility to obesity. PMID: 26769798
  6. 5-HT2A/2C receptor activation reduced glycine receptor current, possibly through interference with cytoskeleton-dependent trafficking or clustering. PMID: 26371055
  7. Research suggests an interactive relationship between medial prefrontal cortex 5-HT2AR and 5-HT2CR, proposing that an imbalance may underlie motor impulsivity. PMID: 26120876
  8. This study demonstrated that the GHS-R1a/5-HT2C receptor interaction significantly modulates ghrelin's orexigenic effect. PMID: 25727097
  9. This study showed serotonin-2C and -2a receptor co-expression on cells in the rat medial prefrontal cortex. PMID: 25818050
  10. During nicotine withdrawal, hippocampal 5-HT2C receptor mRNA levels decrease. PMID: 26031442
  11. Postnatal 5-HT2C expression increased in the suprachiasmatic nucleus, amplifying 5-HT-induced Ca2+ mobilization in differentiated SCN2.2YC cells and developing suprachiasmatic nucleus neurons. PMID: 24531181
  12. TNF-mediated decreases in serotonin receptor 2c gene expression may contribute to disc herniation pathophysiology. PMID: 25141845
  13. Results suggest that the effects of 5-HT2C receptor agonists on progressive ratio schedule performance are mediated by impaired motor capacity rather than reduced food reinforcer incentive value. PMID: 25134499
  14. Research demonstrates the homodimeric structure of endogenously expressed 5-HT2C receptors, identifying the homodimer as a functional signaling unit. PMID: 25609374
  15. High cocaine cue reactivity correlates with lower medial prefrontal cortex 5-HT2CR protein expression and blunted sensitivity to the suppressive effects of the selective 5-HT2CR agonist WAY163909. PMID: 24618688
  16. Early epileptogenesis induced adaptive changes and reorganization in dentate gyrus 5-HT2C receptor systems. PMID: 24935789
  17. In an UNC1-induced stress model, 5-HT2CR expression and activation were observed in brain regions involved in feeding control. PMID: 24269295
  18. Medial prefrontal cortex 5-HT2C receptor genetic loss induces impulsive action in cocaine-dependent animals. PMID: 23939424
  19. [125I](+/-)-4-iodo-2,5-dimethoxyphenyl-isopropylamine labels multiple conformations of both 5-HT2A and 5-HT2C receptors in rat brain. PMID: 23864045
  20. High Impulsivity rats showed decreased DA D2R levels in the NAcb shell and VTA, and increased 5-HT2CR levels in the OFC, along with higher zif268 levels in the NAcbS, NAcbC, and DMS compared to Low Impulsivity rats. PMID: 23632436
  21. 5-HT2CR likely increases motoneuron and interneuron excitability, contributing to tail spasticity after spinal cord injury. PMID: 23337537
  22. Ligands acting on HTR2C may modulate cocaine-induced locomotion through a common mechanism influencing dopamine-dependent circuitry. PMID: 23201361
  23. 5-HT2CR function was down-regulated by both expression levels and alternative splicing in contusive spinal cord injuries. PMID: 23123772
  24. Brain 5-HT2CR mRNA expression is sensitive to organismal physical activity. PMID: 23049953
  25. A multiprotein complex links 5-hydroxytryptamine-activated intracellular signaling events with NMDA-mediated functional activity. PMID: 22291020
  26. 5-HT2CR upregulation in the ACCS is involved in enhanced voluntary alcohol-drinking behavior. PMID: 22512261
  27. rs3813929 (-759C/T) is a functional polymorphism affecting HTR2C expression and influencing antipsychotic-induced weight gain. PMID: 21391883
  28. The 5-HT2CR in the dorsal striatum is involved in expressing instrumental escape deficits caused by uncontrollable stress. PMID: 21958863
  29. Electroacupuncture activates supraspinal serotonin neurons to release 5-HT, which inhibits hyperalgesia by acting on spinal 5-HT1AR, but not 5-HT2CR. PMID: 21556842
  30. Periaqueductal gray 5-HT2C receptors regulate anxiety-related defensive behaviors, but not panic. PMID: 20850460
  31. 5-HT2C receptors co-localize in dopamine and GABA ventral tegmental area neurons projecting to the nucleus accumbens. PMID: 21687728
  32. Genetic disruption of 5-HT2C receptor function does not alter food-seeking motivation. PMID: 20624416
  33. 5-HT2CR editing efficiency is not regulated by extracellular serotonin levels. PMID: 20948451
  34. Motoneuron 5-HT2B and 5-HT2C receptors become constitutively active after injury, contributing to motoneuron function recovery and spasm development. PMID: 20980537
  35. 5-HT2C receptors may generate dyskinesia from associative/limbic territories. PMID: 20447448
  36. 5-HT2C receptor signaling activates a diffuse neural network; arcuate and raphe magnus neurons expressing c-Fos after LPS are not necessary for LPS anorexia. PMID: 19782661
  37. 5-HT7, 5-HT2C, and 5-HT1A receptors are involved in improving schizophrenia-relevant cognitive dysfunction. PMID: 19629447
  38. DOI, a 5-HT2A/2C serotonin receptor agonist, alters cyclooxygenase-2 expression in the rat parietal cortex. PMID: 12369737
  39. Dietary fat may modulate serotonin-2c receptor gene expression in obese rats. PMID: 12429884
  40. Tyrosine kinase receptors regulate GPCRs via MAP kinase; insulin reduces 5-HT2C receptor activity in choroid plexus cells, an effect blocked by the MEK inhibitor PD 098059. PMID: 12795815
  41. 5-HT2A/2C receptor stimulation facilitates capsaicin-evoked substance P-like immunoreactivity release in the dorsal horn. PMID: 14499940
  42. Tuberomamillary neurons express NCX1, NCX2, and NCKX3; 70% express serotonin 2C receptor mRNA, while 10% express 5-HT2A mRNA; all neurons expressing 5-HT2C receptor mRNA also express NCX1 mRNA. PMID: 14535948
  43. Compared to the 5-HT2A receptor, the 5-HT2C receptor is highly expressed at postnatal day 3, with slight increases during further development; it may modulate neuronal plasticity. PMID: 14689478
  44. Retinal neurons, including some third-order neurons (amacrine or ganglion cells), express the 5-hydroxytryptamine 2C receptor gene. PMID: 15193431
  45. Anatomical evidence supports a negative-feedback loop between GABAergic interneurons (bearing 5-HT2A/2C receptors) and 5-HT neurons in the dorsal raphe. PMID: 15652696
  46. Site-directed mutagenesis of *C. elegans* 5-HT2Ce and rat 5-HT2C tested the functional significance of Lys at helix 4.45 and Ser or Cys at helix 7.45. PMID: 15663485
  47. 5-HT2C receptors inhibit nigrostriatal dopaminergic transmission, suggesting regulation via dorsal striatum-localized receptors. PMID: 15668911
  48. Brain 5-HT2C receptors functionally regulate pancreatic regeneration. PMID: 16010984
  49. Medial parabrachial nucleus neurons mediate anorexia through 5-HT2C receptors. PMID: 16343451
  50. PTEN physically interacts with a region in the third intracellular loop (3L4F) of the serotonin 5-HT2C receptor in cell cultures. PMID: 16474401
Database Links

KEGG: rno:25187

STRING: 10116.ENSRNOP00000060345

UniGene: Rn.9935

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the rat 5-hydroxytryptamine receptor 2C and what is its physiological significance?

The rat 5-HT2C receptor is a G protein-coupled receptor (GPCR) that binds the endogenous neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). Like all 5-HT2 receptors, it couples to Gq/G11 and mediates excitatory neurotransmission . The receptor exists as a homodimer at the cell surface, with its crystal structure identified in 2018 . Physiologically, 5-HT2C receptors significantly regulate mood, anxiety, feeding, and reproductive behavior . One of their most critical functions involves the inhibition of dopamine and norepinephrine release in certain brain regions upon activation by serotonin, making this receptor a key modulator of monoaminergic neurotransmission .

How does RNA editing affect rat 5-HT2C receptor function and pharmacology?

RNA editing of the rat 5-HT2C receptor involves the conversion of adenosines to inosines, which can change up to three codons out of a stretch of five in the second intracellular loop of the receptor . This post-transcriptional modification has profound functional consequences for receptor signaling. Research has demonstrated that editing reduces both the binding affinity and functional potency of agonists for recombinant human 5-HT2C receptor isoforms . Importantly, this effect on binding affinity is proportional to the agonist's intrinsic activity, with full agonists being most affected while antagonists show no significant change in binding properties .

The mechanism behind these pharmacological alterations involves changes in coupling energetics within the ternary complex, which affects agonist binding affinities, G protein coupling, and functional responses . This makes RNA editing a sophisticated regulatory mechanism for 5-HT synaptic signaling and neuronal plasticity, potentially contributing to individual variations in response to serotonergic drugs and pathophysiological changes in psychiatric disorders .

What are the differences between edited isoforms of the rat 5-HT2C receptor?

RNA editing of the rat 5-HT2C receptor generates multiple protein isoforms with distinct functional properties. The rat receptor undergoes editing at four adenosine sites, which can change three codons in the second intracellular loop . Human 5-HT2C receptor studies have identified an additional novel editing site in the middle edited codon that extends the repertoire by six additional protein isoforms beyond those identified in rat .

The functional impact of these editing events manifests in altered G-protein coupling efficiency. Edited isoforms generally show decreased constitutive activity and reduced coupling efficiency to G-proteins compared to the non-edited form . This translates to lower potency and efficacy for agonists at edited receptor isoforms. The physiological significance of these isoforms likely relates to fine-tuning serotonergic neurotransmission according to environmental demands and developmental stages, providing an additional layer of regulatory control beyond simple receptor expression levels.

How do selective 5-HT2C receptor agonists affect behaviors mediated by this receptor?

Selective 5-HT2C receptor agonists, such as WAY 163909, demonstrate significant effects on behaviors regulated by this receptor. Experimental data show that WAY 163909 dose-dependently reduces the reinforcing efficacy of both cocaine (ID50=1.19 mg/kg) and sucrose (ID50=0.7 mg/kg) in self-administration paradigms . Additionally, this compound inhibits reinstatement (ID50=0.5 mg/kg) triggered by exposure to cocaine-associated contextual cues, but interestingly does not affect reinstatement elicited by sucrose-associated contextual cues .

The behavioral effects of WAY 163909 occur at doses substantially lower than those that impair locomotor activity. The ID50 required to decrease the reinforcing efficacy of cocaine or sucrose, as well as to suppress cue-induced reinstatement, is approximately 5-12 fold lower than that needed to suppress horizontal ambulation (ID50=5.89 mg/kg) and 2-5 fold lower than that required to suppress vertical activity (ID50=2.3 mg/kg) . This demonstrates that selective 5-HT2C receptor stimulation can modulate reward-related behaviors without causing significant motor impairment, highlighting the potential therapeutic value of targeting this receptor in conditions such as substance use disorders .

What techniques are available for detecting and quantifying 5-HT2C receptors in rat tissue samples?

Several methodological approaches can be employed to detect and quantify 5-HT2C receptors in rat tissue samples:

  • ELISA-based detection: Sandwich ELISA kits specifically designed for rat 5-HT2C receptor quantification offer sensitivity down to 0.083 ng/mL with a detection range of 0.312-20 ng/mL . These assays are suitable for measuring receptor levels in tissue homogenates and other biological fluids.

  • Western blotting: Using antibodies against specific portions of the rat 5-HT2C receptor (such as the third intracellular loop), researchers can identify receptor proteins solubilized from cell lines and rat brain tissue . This approach allows for detection of different glycosylated forms of the receptor with masses ranging from 51-52 kDa and 58-68 kDa .

  • Immunohistochemistry: This technique enables visualization of the receptor's distribution across different brain regions, confirming the higher density in choroid plexus compared to other areas such as hippocampus, striatum, and frontal cortex .

  • Radioligand binding assays: These assays use selective radioligands to quantify receptor density in membrane preparations from different brain regions, providing information about both receptor number and binding affinity.

When selecting a detection method, researchers should consider the specific research question, required sensitivity, and whether information about post-translational modifications (like glycosylation) is needed for interpretation of the results.

How can researchers effectively express recombinant rat 5-HT2C receptors in heterologous systems?

Effective expression of recombinant rat 5-HT2C receptors in heterologous systems requires careful consideration of several factors:

  • Cell line selection: NIH/3T3 fibroblasts have been successfully used to stably express functional rat 5-HT2C receptors . Other commonly used cell lines include HEK-293 and CHO-K1 cells, which have been employed for human 5-HT2C receptor expression studies .

  • Expression vector optimization: The expression vector should contain a strong promoter suitable for the chosen cell line and appropriate selection markers for generating stable cell lines.

  • Glycosylation considerations: Since the 5-HT2C receptor is naturally glycosylated, expression systems that support proper post-translational modifications are preferable. If studying the role of glycosylation specifically, researchers can manipulate this process using tunicamycin to inhibit N-linked glycosylation or neuraminidase to remove sialic acid residues .

  • RNA editing control: To study specific edited isoforms, site-directed mutagenesis can be employed to generate constructs representing each edited variant, allowing for comparative functional studies .

  • Functional validation: Expressed receptors should be validated for proper function using techniques such as calcium mobilization assays, inositol phosphate accumulation, or ERK phosphorylation to confirm coupling to Gq/G11 signaling pathways.

What functional assays are most appropriate for characterizing 5-HT2C receptor pharmacology?

Several functional assays can be employed to characterize 5-HT2C receptor pharmacology:

  • G-protein coupling assays: Since 5-HT2C receptors couple primarily to Gq/G11, assays measuring inositol phosphate (IP) accumulation or calcium mobilization provide direct assessment of receptor function .

  • Binding affinity determination: Competitive binding assays using selective radioligands help determine the affinity of various ligands for the receptor. Studies have shown that RNA editing affects binding affinity proportionally to the agonist's intrinsic activity .

  • Agonist potency assessment: Concentration-response curves for receptor-mediated functional responses allow determination of agonist potency (EC50) and efficacy (Emax). These parameters have been shown to differ between edited and non-edited receptor isoforms .

  • Behavioral paradigms: In vivo assays measuring parameters like self-administration and reinstatement behaviors can assess the functional effects of 5-HT2C receptor modulation in intact animal models. For example, studies with WAY 163909 have demonstrated dose-dependent effects on cocaine and sucrose self-administration .

When characterizing novel ligands, it is important to assess their selectivity across 5-HT2 receptor subtypes (5-HT2A, 5-HT2B, and 5-HT2C) due to the high homology between these receptors and potential clinical concerns associated with 5-HT2A agonism (hallucinations) and 5-HT2B agonism (cardiac valvulopathy) .

How are recombinant rat 5-HT2C receptors utilized in drug development research?

Recombinant rat 5-HT2C receptors serve as valuable tools in drug development research, particularly for compounds targeting psychiatric and metabolic disorders. Selective 5-HT2C receptor agonists show promise as therapeutic agents for conditions including substance use disorders, obesity, and eating disorders . The differential effects of WAY 163909 on cocaine versus sucrose reinforcement highlight the potential for developing treatments that specifically target drug reward mechanisms while minimizing effects on natural rewards .

When screening compounds, researchers typically assess:

  • Selectivity profiles: Testing compounds across all three 5-HT2 receptor subtypes (5-HT2A, 5-HT2B, 5-HT2C) is essential, as cross-reactivity could lead to serious side effects including hallucinations (5-HT2A) or cardiac valvulopathy (5-HT2B) .

  • Efficacy at different edited isoforms: Since RNA editing alters agonist potency and efficacy, compounds should be characterized across multiple receptor isoforms to understand their potential clinical efficacy in populations with different editing profiles .

  • In vivo efficacy at behaviorally relevant doses: The therapeutic window between desired effects (e.g., reduction in cocaine reinforcement) and unwanted effects (e.g., locomotor suppression) is critical for determining clinical potential .

What insights have studies of the 5-HT2C receptor provided regarding neuropsychiatric disorders?

Research on 5-HT2C receptors has yielded important insights into neuropsychiatric disorders. Studies have found that some suicide victims have an abnormally high number of 5-HT2C receptors in the prefrontal cortex, suggesting altered serotonergic function in suicidal behavior . The receptor's role in regulating dopamine release in key brain regions, including the striatum, prefrontal cortex, nucleus accumbens, hippocampus, hypothalamus, and amygdala, connects it to the pathophysiology of multiple psychiatric disorders involving dopaminergic dysfunction .

Additionally, agomelatine, which functions as a 5-HT2C and 5-HT2B antagonist as well as a MT1 and MT2 agonist, has proven effective as an antidepressant . Its mechanism has been termed "norepinephrine-dopamine disinhibition" because antagonism of 5-HT2C receptors results in increased dopamine and norepinephrine activity in the frontal cortex . This mechanism differs from that of many SSRIs, highlighting alternative approaches to treating mood disorders through serotonergic systems.

What emerging areas of 5-HT2C receptor research warrant further investigation?

Several promising research directions for 5-HT2C receptors merit further exploration:

  • Sex differences in receptor function: Given that the HTR2C gene is located on the X chromosome in humans, with males having one copy and females having one of two copies repressed, polymorphisms at this receptor can affect the sexes differently . This suggests important potential sex differences in response to 5-HT2C-targeting therapeutics that require systematic investigation.

  • RNA editing regulation: The mechanisms controlling RNA editing of the 5-HT2C receptor and how these processes are altered in disease states remain incompletely understood. Research into the enzymes and regulatory factors governing editing could reveal new therapeutic targets .

  • Targeted drug delivery: Developing methods to deliver 5-HT2C receptor agonists specifically to brain regions involved in addiction processes while sparing areas mediating natural rewards could enhance therapeutic efficacy while reducing side effects .

  • Allosteric modulation: Identification of allosteric modulators of the 5-HT2C receptor could provide more subtle control over receptor function compared to direct agonists or antagonists, potentially offering improved therapeutic profiles.

  • Heterodimer interactions: While the 5-HT2C receptor forms homodimers , its potential interactions with other GPCRs through heterodimer formation represent an understudied area that could reveal novel functional properties and drug targets.

These research directions could significantly advance our understanding of 5-HT2C receptor biology and accelerate the development of novel therapeutics for psychiatric and metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.