Recombinant Rat 5-hydroxytryptamine receptor 5A (Htr5a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat 5-Hydroxytryptamine Receptor 5A (Htr5a)

The recombinant rat 5-hydroxytryptamine receptor 5A (Htr5a) is a synthetic, lab-produced version of the native serotonin receptor subtype 5-HT5A. This protein is engineered for research purposes to study receptor structure, ligand binding, and downstream signaling pathways. As a member of the G protein-coupled receptor (GPCR) family, it couples to G<sub>i/o</sub> proteins, influencing intracellular calcium mobilization and cAMP levels . Below is a detailed analysis of its production, applications, and research insights.

Expression Systems and Production

Recombinant Htr5a is produced using diverse expression systems to optimize yield and functional integrity. Key methods include:

Expression SystemTags/ModificationsSupplier ExamplesApplications
E. coliHis-tag, GSTCusabio (CSB-CF010896RA)Purification, binding assays
YeastDDK-tag, Myc-tagCreative BioMartStructural studies
BaculovirusAvi-tag, Fc-tagCusabio (CSB-EP010896RA1)Functional assays
Mammalian cellsNative sequenceMyBioSourceNative conformation studies

Note: Tags facilitate purification, detection, or structural analysis. Mammalian systems ensure proper post-translational modifications .

Electrophysiological Characterization

In ex vivo rodent prefrontal cortex slices, native 5-HT5A receptors mediate an inwardly rectifying K<sup>+</sup> current via Kir3 channels, suppressing neuronal excitability. Recombinant Htr5a has been used to validate these findings:

  • Activation: Submicromolar 5-HT concentrations (EC<sub>50</sub>: 0.6–0.9 μM) .

  • Antagonism: SB-699551 (10 μM) blocks currents, confirming receptor specificity .

  • Compensatory Plasticity: Knockout of native 5-HT5A in mice upregulates 5-HT1A receptor currents, indicating receptor crosstalk .

Functional Roles in Disease Models

Disease/ConditionHtr5a InvolvementSupporting Evidence
Neuropathic PainAntinociceptive effectsAgonists like 5-CT reduce pain in rodent models .
Psychosis/DepressionTherapeutic TargetSelective antagonists (e.g., SB-699551) modulate cortical signaling .
Memory RegulationPresynaptic AutoreceptorHtr5a knockout mice show altered 5-HT1A receptor expression .

Applications in Research and Drug Development

Recombinant Htr5a is critical for:

  1. Ligand Screening: Identifying agonists/antagonists with high affinity (e.g., 5-CT, SB-699551) .

  2. Structural Biology: Resolving receptor-ligand interactions via cryo-EM .

  3. Functional Assays: Studying G<sub>i/o</sub> coupling in vitro (e.g., cAMP inhibition) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Htr5a; 5ht5a; 5-hydroxytryptamine receptor 5A; 5-HT-5A; 5-HT5A; REC17; Serotonin receptor 5A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MDLPINLTSFSLSTPSTLEPNRSLDTEALRTSQSFLSAFRVLVLTLLGFLAAATFTWNLL VLATILRVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFG WGETYSELSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYKAAKFRMGSRKTNSVS PIPEAVEVKDASQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP FFVTELISPLCSWDIPALWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
Uniprot No.

Target Background

Function

This recombinant Rat 5-hydroxytryptamine receptor 5A (Htr5a) is one of several receptors for 5-hydroxytryptamine (serotonin), a bioactive hormone functioning as a neurotransmitter, hormone, and mitogen. Its activity is G protein-mediated.

Gene References Into Functions
  1. Studies indicate that 5-HT5A receptors modulate pain processing in the spinal cord. PMID: 26168890
  2. While 5-HT5A receptor gene expression remains unchanged in the hippocampus across treated groups, leptin and serotonin treatment in rats significantly reduces 5-HT5A receptor immunostaining in the dentate gyrus. PMID: 20863873
  3. 5-HT5A receptor-like immunoreactivity has been observed in cerebellar cortex neuronal somata and deep cerebellar nuclei. PMID: 12084412
  4. The 5-HT5A receptor gene is expressed in the embryonic rat brain and exhibits differential expression during development. PMID: 15823424
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Central nervous system.

Q&A

What is the structural organization of the rat 5-HT5A receptor?

The rat 5-HT5A receptor is a G protein-coupled receptor encoded by the Htr5a gene, located on chromosome 4q11 in rats. It consists of 357 amino acids organized into 7 transmembrane domains, characteristic of class A GPCRs . The receptor is a member of the 5-hydroxytryptamine receptor family and functions primarily through negative coupling to adenylyl cyclase via Gi/Go proteins .

Unlike humans who express only functional 5-HT5A receptors, rats possess both functional 5-HT5A and 5-HT5B receptor subtypes. This represents an important species difference, as the human 5-HT5B gene contains stop codons making it non-functional . Despite these differences, the rat 5-HT5A receptor shares significant structural homology with the human variant, making it a valuable model for studying this receptor class.

The rat Htr5a gene has been well-characterized, with specific chromosomal localization (4q11) and gene structure that allows for expression in recombinant systems . Understanding this organization is crucial for designing genetic manipulation experiments to study receptor function.

What primary signaling mechanisms are associated with the rat 5-HT5A receptor?

The rat 5-HT5A receptor primarily signals through inhibitory G-proteins (Gi/Go), leading to several downstream effects including:

  • Inhibition of adenylyl cyclase activity, resulting in decreased intracellular cAMP levels

  • Reduction in protein kinase A (PKA) activity

  • Possible regulation of intracellular Ca2+ mobilization

  • Decreased phosphorylation of downstream targets of PKA

Research has demonstrated that stimulation of the 5-HT5A receptor with agonists such as 5-carboxamidotryptamine (5-CT) results in a dose-dependent increase in [35S]-GTPγS binding, indicating G-protein activation . This is accompanied by a dose-dependent inhibition of cyclic AMP accumulation, confirming functional coupling to inhibitory G-proteins .

Intracellular signaling cascades triggered by receptor activation include a ligand-stimulated reduction in the detectable level of the catalytic domain of protein kinase A (PKA) in nuclear extracts. This observation is consistent with the reduction in cAMP levels following receptor activation .

How does the pharmacological profile of rat 5-HT5A differ from human 5-HT5A?

Key pharmacological agents for studying rat 5-HT5A include:

Agonists:

  • 5-Carboxamidotryptamine (5-CT): Full agonist, though not selective

  • LSD ((+)-lysergic acid): Non-selective agonist

  • Lisuride: Partial agonist

  • Methylergometrine: Full agonist

  • Valerenic acid: Partial agonist component of valerian

Antagonists:

  • Various compounds have been identified through structure-based design and molecular docking approaches, though highly selective antagonists remain limited

Few highly selective ligands are commercially available for the 5-HT5A receptor, complicating pharmacological studies. When selective activation of this receptor is desired in research, non-selective serotonin receptor agonists like 5-CT can be used in conjunction with selective antagonists for its other targets (principally 5-HT1A, 5-HT1B, 5-HT1D, and 5-HT7) .

What expression systems are most effective for studying recombinant rat 5-HT5A receptors?

Several expression systems have been utilized for recombinant rat 5-HT5A receptor studies, with HEK-293 cells being among the most effective. This is supported by research demonstrating successful expression and functional coupling of human 5-HT5A receptors in this cell line .

The comparative effectiveness of common expression systems is summarized below:

Expression SystemAdvantagesLimitationsFunctional Coupling
HEK-293 cellsHigh transfection efficiency, mammalian post-translational modificationsEndogenous expression of some signaling moleculesDemonstrated coupling to Gi/Go proteins
CHO-K1 cellsLow endogenous receptor expression, stable transfection possibleLower transfection efficiency than HEK-293Requires optimization for optimal coupling
COS-7 cellsHigh protein expression levelsTransient expression systemVariable coupling efficiency
Sf9 insect cellsHigh expression levels for structural studiesNon-mammalian post-translational modificationsMay not fully reproduce mammalian coupling

When establishing a recombinant expression system, researchers should consider:

  • Expression levels (higher isn't always better as overexpression can lead to constitutive activity)

  • Post-translational modifications relevant to receptor function

  • Endogenous expression of signaling partners

  • Stability of expression over time and passages

  • Compatibility with downstream assay systems

How can functional coupling of recombinant rat 5-HT5A to G-proteins be measured?

Multiple methodologies exist for measuring functional coupling of recombinant rat 5-HT5A receptors to G-proteins, each with specific advantages:

  • [35S]-GTPγS Binding Assay:

    • Measures the exchange of GDP for GTP on Gα-subunits upon receptor activation

    • Has been successfully used with 5-HT5A receptors showing dose-dependent increases in binding following stimulation with 5-CT

    • Provides direct measurement of G-protein activation at the earliest stage of signaling

  • cAMP Accumulation Assays:

    • Measures the inhibition of forskolin-stimulated cAMP production

    • Demonstrated to show dose-dependent inhibition of cAMP accumulation in recombinant 5-HT5A receptor cell lines

    • Can be measured using various techniques including ELISA, radioimmunoassay, or FRET-based biosensors

  • PKA Translocation Assay:

    • Measures reductions in nuclear PKA catalytic subunits following receptor activation

    • Consistent with the decrease in cAMP levels and subsequent reduction in PKA activity

    • Provides insight into downstream functional consequences of receptor activation

  • BRET/FRET-based G-protein Activation Assays:

    • Utilizes energy transfer between tagged receptor and G-protein components

    • Allows real-time measurement of receptor-G-protein interactions in living cells

    • Useful for studying kinetics of activation/deactivation

When selecting an assay system, researchers should consider the signal-to-noise ratio, dynamic range, and compatibility with their experimental design. For inhibitory G-protein coupling like that of 5-HT5A, measuring the inhibition of stimulated activity often provides the most robust signal window.

What homology modeling approaches can inform rat 5-HT5A structure-function relationships?

Homology modeling represents a powerful approach for studying 5-HT5A receptor structure in the absence of experimentally determined structures. For the 5-HT5A receptor, structural models have been developed using related 5-HT receptors as templates .

A systematic approach to 5-HT5A homology modeling includes:

  • Template Selection:

    • The crystal structure of 5-HT1BR in complex with ergotamine has been used successfully (PDB: 4IAR, 4IAQ)

    • Multiple templates may be employed to model different conformational states

  • Sequence Alignment and Model Building:

    • Alignments can be generated using tools like PROMALS3D with sequences from human 5-HT1BR, 5-HT2AR, and 5-HT2BR

    • Manual editing is often necessary to optimize alignments, particularly in loop regions

    • Generation of multiple models (e.g., 1000) using software like MODELLER to explore conformational space

  • Model Validation:

    • Models can be evaluated by their ability to enrich known 5-HT5A ligands over property-matched decoys through docking to the orthosteric site

    • Assessment metrics include adjusted logAUC and enrichment factors at 1% of the database (EF1%)

    • The fidelity of docked ligand poses compared to crystallographic structures in template structures

  • Optimization:

    • Further refinement through minimization with the AMBER protein force field and GAFF ligand force field

    • Re-assessment of model quality after minimization

These models have been successfully used to virtually screen large compound libraries (>6 million molecules) against the orthosteric site of the 5-HT5A receptor, leading to the identification of novel ligands with improved selectivity profiles .

What strategies exist for developing selective ligands for rat 5-HT5A receptors?

  • Structure-Based Virtual Screening:

    • Utilizing homology models of the 5-HT5A receptor to screen large virtual libraries

    • Iterative cycles of docking, pharmacological testing, and structural refinement

    • This approach has successfully identified novel chemical scaffolds with improved selectivity profiles compared to existing compounds

  • Probe-Pair Approach:

    • Development of structurally similar molecules with differential activity at 5-HT5A

    • Property-matched probe-pairs that control for off-target activities provide more confidence in attributing biological effects to 5-HT5A activity

    • Allows for more robust target validation in complex biological systems

  • Allosteric Modulator Development:

    • Targeting binding sites distinct from the orthosteric (serotonin-binding) site

    • These regions tend to be less conserved across receptor subtypes

    • May provide greater subtype selectivity than orthosteric ligands

  • Fragment-Based Drug Discovery:

    • Screening small molecular fragments that bind to specific receptor regions

    • Gradual building and linking of fragments to develop selective ligands

    • Can access novel chemical space not explored by traditional screening approaches

For studies requiring selective activation of the 5-HT5A receptor, researchers often employ a combination approach using non-selective agonists like 5-carboxamidotryptamine in conjunction with selective antagonists for its other targets . This pharmacological isolation strategy allows for the study of 5-HT5A-specific responses despite the limited availability of highly selective compounds.

How can genetic engineering approaches enhance recombinant rat 5-HT5A research?

Genetic engineering technologies offer powerful tools for manipulating recombinant rat 5-HT5A expression systems to address specific research questions:

  • Epitope and Fluorescent Protein Tagging:

    • Addition of epitope tags (HA, FLAG, His) facilitates detection and purification

    • Fusion with fluorescent proteins enables visualization of receptor trafficking and localization

    • Care must be taken to ensure tags don't interfere with receptor function

  • Site-Directed Mutagenesis:

    • Precise modification of key residues in binding pockets to alter ligand selectivity

    • Mutation of G-protein coupling domains to study signaling mechanisms

    • Creation of phosphorylation-deficient mutants to examine regulatory mechanisms

  • Inducible Expression Systems:

    • Tetracycline-controlled transcriptional activation allows temporal control of expression

    • Helps avoid adaptive responses to constitutive receptor expression

    • Enables titration of expression levels to avoid artifacts from overexpression

  • Biosensor Integration:

    • Development of cell lines with integrated cAMP or Ca2+ sensors

    • Creation of fusion constructs linking the receptor to BRET/FRET sensors

    • Facilitates real-time monitoring of signaling events in living cells

  • CRISPR-Cas9 Genome Editing:

    • Targeted integration of rat Htr5a into safe harbor loci for stable expression

    • Knockout of competing signaling pathways to isolate 5-HT5A-mediated effects

    • Introduction of human variants for comparative studies

These approaches not only enhance the utility of recombinant systems but also allow researchers to address specific mechanistic questions about receptor function, regulation, and pharmacology that would be difficult to study in native tissues.

What techniques can reveal 5-HT5A receptor dimerization and protein-protein interactions?

Understanding 5-HT5A receptor interactions with other proteins, including potential homo- and heterodimerization, provides important insights into its function and regulation. Several complementary approaches can be employed:

  • Resonance Energy Transfer Techniques:

    • Bioluminescence Resonance Energy Transfer (BRET): Tags one receptor with luciferase and another with a fluorescent protein

    • Förster Resonance Energy Transfer (FRET): Uses two fluorescent proteins with overlapping emission/excitation spectra

    • Both techniques detect proximity within 10nm, suitable for studying direct protein interactions

    • Allow for real-time monitoring in living cells

  • Protein Complementation Assays:

    • Split luciferase complementation: Receptor partners tagged with N- and C-terminal fragments of luciferase

    • BiFC (Bimolecular Fluorescence Complementation): Similar principle using split fluorescent proteins

    • Provide binary (yes/no) indication of protein interaction with spatial resolution

  • Co-immunoprecipitation Approaches:

    • Differentially tag potential interaction partners (e.g., FLAG-5-HT5A and HA-tagged partners)

    • Immunoprecipitate one protein and detect co-precipitated partners by western blotting

    • Can be combined with crosslinking to capture transient interactions

  • Proximity Ligation Assay (PLA):

    • Utilizes antibodies against interaction partners

    • Secondary antibodies with attached oligonucleotides form amplifiable DNA when in close proximity

    • Provides single-molecule sensitivity with spatial resolution in fixed cells or tissues

  • Mass Spectrometry-Based Interactomics:

    • Immunoprecipitation or proximity labeling followed by mass spectrometry

    • Identifies interaction partners without prior knowledge

    • Quantitative approaches can compare interaction profiles under different conditions

For studying 5-HT5A receptor dimerization specifically, BRET saturation assays represent a particularly robust approach, allowing researchers to distinguish specific interactions from random collisions by varying the ratio of donor to acceptor-tagged receptors.

How does rat 5-HT5A receptor signaling impact neurophysiological processes?

The 5-HT5A receptor participates in multiple neurophysiological processes through its inhibitory G-protein signaling cascade. Understanding these impacts is crucial for interpreting research findings:

The neurotransmitter serotonin has been implicated in a wide range of psychiatric conditions and also exhibits vasoconstrictive and vasodilatory effects . The 5-HT5A receptor contributes to these processes through several mechanisms:

  • Regulation of Neuronal Excitability:

    • By inhibiting adenylyl cyclase and reducing cAMP levels, 5-HT5A activation can decrease neuronal excitability

    • This occurs through reduced PKA-mediated phosphorylation of ion channels and other effector proteins

    • May serve as a mechanism for fine-tuning neuronal responses to serotonergic signaling

  • Modulation of Memory and Cognition:

    • Agonists and antagonists for 5-HT receptors, including 5-HT5A, present promnesic (memory-promoting) and/or anti-amnesic effects under different conditions

    • These receptors are associated with neural changes important for learning and memory processing

  • Presynaptic Autoreceptor Function:

    • Evidence suggests 5-HT5A receptors may function as presynaptic serotonin autoreceptors

    • In this capacity, they would provide negative feedback regulation of serotonin release

    • This represents an important mechanism for modulating serotonergic neurotransmission

  • Potential Role in Neuropathic Pain:

    • Research has investigated a hypothesized role for the 5-HT5A receptor in neuropathic pain models

    • This suggests involvement in sensory processing pathways

Understanding these neurophysiological roles informs experimental design and interpretation when studying recombinant rat 5-HT5A receptors, particularly when translating findings from in vitro systems to in vivo contexts.

What methodological considerations are important when comparing native and recombinant rat 5-HT5A systems?

When interpreting data from recombinant rat 5-HT5A receptor systems and extrapolating to native contexts, several important methodological considerations must be addressed:

  • Expression Level Differences:

    • Recombinant systems typically express receptors at significantly higher levels than native tissues

    • Over-expression can lead to constitutive activity, altered pharmacology, and non-physiological protein interactions

    • Quantification of receptor density and comparison to native levels is important for interpretation

  • Post-translational Modification Differences:

    • Native neural tissues may produce receptor variants with specific glycosylation, phosphorylation, or other modifications

    • These modifications can affect ligand binding, signaling efficiency, and receptor trafficking

    • Expression system selection should consider the capacity to reproduce relevant modifications

  • Signaling Partner Availability:

    • The complement of G-proteins, regulators of G-protein signaling (RGS proteins), and effector molecules differs between expression systems and native tissues

    • These differences can affect apparent potency, efficacy, and signaling bias of ligands

    • Co-expression of relevant signaling partners may be necessary for faithful recapitulation of native signaling

  • Membrane Environment Effects:

    • Lipid composition varies between expression systems and native neural membranes

    • Membrane cholesterol content and microdomain organization impact receptor conformation and function

    • Consideration of membrane modifiers or alternative expression systems may be warranted

  • Functional Readout Selection:

    • Different assay systems measure different aspects of receptor function (G-protein coupling, cAMP inhibition, downstream effector activation)

    • Selection of appropriate functional readouts that align with the research question is critical

    • Multimodal assessment using complementary assays strengthens data interpretation

By carefully considering these factors, researchers can develop more physiologically relevant recombinant systems and more accurately translate findings between in vitro and in vivo contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.