Recombinant Rat 5-hydroxytryptamine receptor 7 (Htr7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat 5-Hydroxytryptamine Receptor 7 (HTR7)

Recombinant Rat 5-Hydroxytryptamine Receptor 7 (HTR7) is a genetically engineered protein expressed in heterologous systems (e.g., E. coli or mammalian cells) to study its structure, function, and therapeutic potential. This receptor belongs to the G protein-coupled receptor (GPCR) family and plays a critical role in regulating physiological processes such as circadian rhythms, mood, and inflammation. Below is a detailed analysis of its characteristics, functional mechanisms, and research applications.

Functional Mechanisms of HTR7

HTR7 mediates intracellular signaling through two primary pathways:

3.1. Gs-Protein Coupling

Activation of HTR7 by serotonin (5-HT) triggers the dissociation of the Gs protein, which stimulates adenylate cyclase, increasing intracellular cAMP levels. This pathway is critical for:

  • Smooth muscle relaxation in vasculature and gastrointestinal tract .

  • Neurotransmission modulation in the hippocampus and cortex .

3.2. G12-Protein Coupling

HTR7 also couples with G12 proteins, activating small GTPases (RhoA and Cdc42), which regulate:

  • Cytoskeletal remodeling (e.g., dendritic spine formation) .

  • Inflammatory responses in immune cells and the gastrointestinal tract .

Research Applications of Recombinant Rat HTR7

Recombinant HTR7 is utilized in diverse experimental contexts:

ApplicationDetails
Drug DiscoveryScreening agonists/antagonists (e.g., SB-269970) for depression and Alzheimer’s disease .
Signaling Pathway StudiesInvestigating cAMP-dependent and RhoA/Cdc42-mediated mechanisms .
Disease ModelingStudying HTR7’s role in hypertension (via knockout rats) and neuroinflammation .

5.1. Cardiovascular Regulation

Knockout rat models lacking functional HTR7 exhibit reduced blood pressure responses to serotonin, confirming its role in vascular tone regulation .

5.2. Neurological and Psychiatric Disorders

  • Depression: HTR7 antagonists (e.g., methiothepin) show antidepressant-like effects in preclinical models .

  • Alzheimer’s Disease: Agonists like AS19 reduce amyloid-β plaques and improve cognition .

5.3. Inflammatory Processes

HTR7 modulates cytokine production in dendritic cells and gut inflammation, suggesting therapeutic potential for irritable bowel syndrome .

Challenges and Future Directions

  • Knockout Model Limitations: Residual mRNA in HTR7 knockout rats complicates interpretation, necessitating complementary pharmacological approaches .

  • Splice Variants: Rat HTR7 lacks the human-specific splice variants (e.g., HTR7(d)), limiting cross-species comparisons .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Htr7; 5-hydroxytryptamine receptor 7; 5-HT-7; 5-HT7; 5-HT-X; GPRFO; Serotonin receptor 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MMDVNSSGRPDLYGHLRSLILPEVGRGLQDLSPDGGAHPVVSSWMPHLLSGFLEVTASPA PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVQPESVISLNGVVKLQK EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE ALKLAERPERSEFVLQNSDHCGKKGHDT
Uniprot No.

Target Background

Function

This product is a recombinant Rat 5-hydroxytryptamine receptor 7 (Htr7). Htr7 is one of several receptors for 5-hydroxytryptamine (serotonin), a bioactive molecule functioning as a neurotransmitter, hormone, and mitogen. Its activity is mediated by G proteins that stimulate adenylate cyclase. This receptor plays a role in regulating mammalian circadian rhythms.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Thalamus, hypothalamus, and the hippocampal rudiments.

Q&A

What are the structural characteristics of rat 5-HT7 receptor?

The rat 5-hydroxytryptamine 7 (5-HT7) receptor belongs to the G protein-coupled receptor (GPCR) family. Structurally, it shares highest homology with the 5-HT dro1 receptor (56% homology in transmembrane domains) and lower homologies with other 5-HT receptors such as 5-HT1A (40%), 5-HT1B (43%), and 5-HT2A (35%) . The receptor features seven transmembrane domains characteristic of GPCRs, with the primary structure well-conserved across mammalian species . The rat 5-HT7 receptor exhibits high affinity for the endogenous ligand 5-HT with pKi values typically ranging between 8.1-9.0, and even higher affinity for 5-CT (pKi 9.0-9.4) . One notable feature is its relatively high affinity for 8-OH-DPAT, which was previously considered a selective 5-HT1A receptor agonist before the discovery of the 5-HT7 receptor .

How many isoforms of rat 5-HT7 receptor exist and how do they differ?

Rat 5-HT7 receptor pre-mRNA undergoes alternative splicing to produce three distinct isoforms: 5-HT7a, 5-HT7b, and 5-HT7c . These isoforms differ specifically in the amino acid sequences of their carboxyl-terminal tails while maintaining identical transmembrane domains and binding pockets . The distribution pattern of these isoforms represents a species-specific characteristic, with substantial differences observed between rat and human expression patterns . In rat tissues, the 5-HT7a isoform predominates in all brain regions examined, while the 5-HT7c isoform shows notably low expression levels (approximately 3% of total 5-HT7 receptor transcript) . This pattern contrasts with the distribution observed in human tissues, highlighting important species differences that researchers must consider when designing experiments or interpreting results across species .

How should researchers analyze 5-HT7 receptor expression in experimental tissues?

For comprehensive analysis of 5-HT7 receptor expression in experimental tissues, researchers should employ a multi-method approach. RT-PCR provides sensitive detection of receptor mRNA and can distinguish between the three isoforms using primer sets targeting unique C-terminal sequences . For quantitative analysis, real-time qRT-PCR allows determination of relative expression levels of each isoform, as demonstrated in studies comparing expression between cortical and striatal regions . Western blot analysis using antibodies against the 5-HT7 receptor can confirm protein expression, though care must be taken to normalize to housekeeping proteins like β-actin . For spatial localization, in situ hybridization using isoform-specific probes provides valuable information about cellular distribution patterns . When examining receptor functionality, coupling to adenylate cyclase can be assessed by measuring cAMP production following stimulation with selective agonists like LP-211, with specificity confirmed using antagonists such as SB-269970 .

What are the recommended protocols for establishing recombinant rat 5-HT7 receptor expression systems?

For establishing reliable recombinant rat 5-HT7 receptor expression systems, researchers should consider the following methodological approach:

  • Vector selection and cloning: Clone the full-length rat 5-HT7 receptor cDNA (including desired isoform) into mammalian expression vectors containing strong promoters (e.g., CMV) and appropriate selection markers .

  • Cell line selection: COS-7 cells are well-suited for binding studies, while JEG-3 cells have demonstrated efficient coupling to adenylate cyclase for functional assays . HEK-293 cells also provide a reliable expression system for studying signaling properties .

  • Transfection methods: Use either calcium phosphate precipitation, lipofection, or electroporation depending on cell type, with optimization of DNA concentration and transfection conditions for each system .

  • Verification of expression: Confirm receptor expression through RT-PCR, Western blotting, and immunocytochemistry before proceeding to functional assays .

  • Stable cell line generation: For long-term studies, select transfected cells using appropriate antibiotics and isolate single clones to establish stable cell lines with consistent receptor expression levels .

  • Functional validation: Verify receptor functionality through [³H]5-HT binding assays and cAMP accumulation studies using known agonists (5-HT, 5-CT) and antagonists (SB-269970) .

This systematic approach ensures reliable expression and functional activity of recombinant rat 5-HT7 receptors for subsequent experimental investigations.

What are the most effective pharmacological tools for studying rat 5-HT7 receptor function?

The most effective pharmacological tools for studying rat 5-HT7 receptor function include both agonists and antagonists with established selectivity profiles:

Selective Agonists:

  • LP-211: A highly selective 5-HT7 receptor agonist that has been extensively validated in neuronal culture systems and behavioral models . At 100 nM concentration, LP-211 induces significant neurite elongation in cultured neurons, with effects blocked by selective antagonists .

  • 5-CT (5-carboxamidotryptamine): Exhibits high affinity for 5-HT7 receptors (pKi 9.0-9.4) but also binds to other 5-HT receptor subtypes, necessitating the use of selective antagonists to isolate 5-HT7-mediated effects .

Selective Antagonists:

  • SB-269970: The most widely used selective 5-HT7 receptor antagonist, with high affinity and selectivity for blocking receptor-mediated effects . Co-application of SB-269970 with LP-211 completely abolishes 5-HT7 receptor-dependent neurite elongation in neuronal cultures .

Experimental Validation:
When employing these tools, researchers should systematically establish dose-response relationships and confirm receptor specificity through antagonist blockade . For instance, in neurite outgrowth experiments, co-treatment of cultures with LP-211 (100 nM) and SB-269970, followed by morphometric analysis using Tuj1 antibody staining, provides a reliable method for measuring 5-HT7 receptor-mediated effects on neuronal morphology .

How can microfluidic chambers be utilized to study 5-HT7 receptor-mediated neurite outgrowth?

Microfluidic chambers represent an advanced experimental approach for studying 5-HT7 receptor-mediated neurite outgrowth, particularly for distinguishing axonal from dendritic growth processes:

  • Chamber design and setup: Implement chambers with two compartments (soma compartment and axon compartment) connected by microchannels (450 μm long) that allow axonal growth while restricting dendritic passage .

  • Cell plating and stimulation: Plate neurons (e.g., hippocampal neurons) in the soma compartment and add 5-HT7 receptor agonist (e.g., LP-211, 100 nM) to both compartments to ensure consistent stimulation .

  • Verification of axonal identification: Validate that only axons traverse the microchannels by co-immunolabeling with both Tuj1 (general neuronal marker) and axon-specific (Tau) versus dendrite-specific (Map2) markers . Confirm that Tau immunoreactivity is present in both compartments while Map2 labeling remains restricted to the soma compartment .

  • Quantification protocol: Count the number of axons crossing microchannels daily from 1DIV to 6DIV to establish a temporal profile of 5-HT7 receptor-mediated axonal growth . This approach allows for distinguishing early (3-5DIV) versus late effects and potential receptor desensitization .

  • Data analysis: Compare axon counts between vehicle control and agonist-treated cultures, with statistical analysis to determine significance of observed differences at each time point .

This methodology has revealed that stimulation of 5-HT7 receptors with LP-211 significantly increases axonal growth during early developmental stages (3-5DIV), suggesting a specific role in axonal pathfinding and potential applications in axonal regeneration strategies .

What intracellular signaling pathways mediate 5-HT7 receptor function in neurons?

The rat 5-HT7 receptor activates multiple intracellular signaling cascades that collectively regulate neuronal development and function:

  • cAMP/PKA pathway: 5-HT7 receptors positively couple to adenylate cyclase through Gαs proteins, stimulating cAMP production . This is the primary signaling mechanism identified across various cell types and recombinant expression systems .

  • ERK phosphorylation: 5-HT7 receptor activation with selective agonists like LP-211 promotes phosphorylation of extracellular signal-regulated kinases (ERK), which contribute to neurite elongation mechanisms .

  • Cdk5 activation: Cyclin-dependent kinase 5 (Cdk5) represents another signaling component activated during 5-HT7 receptor-dependent neurite elongation .

  • mTOR pathway: The mammalian target of rapamycin (mTOR) signaling cascade is activated downstream of 5-HT7 receptor stimulation and contributes to cytoskeletal remodeling processes .

  • Cdc42 activation: The small GTPase Cdc42 becomes activated following 5-HT7 receptor stimulation, providing a direct link to actin cytoskeleton dynamics .

These converging pathways collectively modulate the dynamics of neuronal cytoskeleton proteins, with particular effects on actin remodeling that drives morphological changes including neurite and axonal elongation . The relative contribution of each pathway may vary depending on the neuronal subtype and developmental stage, necessitating careful experimental design when investigating specific signaling components.

How do the signaling properties of different rat 5-HT7 receptor isoforms compare?

  • Receptor phosphorylation patterns: The distinct C-terminal sequences may contain different phosphorylation sites affecting receptor desensitization and internalization dynamics.

  • Regulatory processes: Interactions with regulatory proteins like β-arrestins may vary between isoforms.

  • Coupling to secondary effector systems: Beyond adenylate cyclase, differential coupling to alternative signaling pathways remains possible.

  • Subcellular trafficking: Differences in membrane targeting, recycling, or compartmentalization could influence signaling specificity.

These potential functional differences require further investigation with sophisticated methodologies capable of detecting subtle variations in signaling dynamics or subcellular localization .

How does 5-HT7 receptor activation influence neuronal morphology and development?

5-HT7 receptor activation exerts profound effects on neuronal morphology and development, particularly through the stimulation of neurite outgrowth and axonal elongation. Pharmacological stimulation of 5-HT7 receptors using the selective agonist LP-211 (100 nM) induces significant enhancement of neurite outgrowth in primary neuronal cultures derived from multiple brain regions, including the cortex, hippocampus, and striatal complex . This effect is receptor-specific, as co-treatment with the selective 5-HT7 receptor antagonist SB-269970 completely abolishes the neurite elongation . Importantly, microfluidic chamber experiments have demonstrated that 5-HT7 receptor stimulation specifically promotes axonal growth, with LP-211-treated cultures showing a significant increase in the number of axons crossing microchannels between 3-5 days in vitro . This effect on axonal development suggests potential roles in axonal pathfinding during development and possible applications in axonal regeneration strategies .

At the molecular level, 5-HT7 receptor-mediated neurite elongation involves the coordinated activation of multiple signaling pathways converging on cytoskeletal remodeling, including ERK phosphorylation, Cdk5 activation, mTOR stimulation, and Cdc42 activation . The integrated action of these pathways ultimately results in the modulation of actin cytoskeleton dynamics that drive neurite extension . These findings position the 5-HT7 receptor as an important regulator of neuronal morphogenesis with potential implications for understanding neurodevelopmental processes and designing therapeutic strategies for neuronal repair.

What is the evidence linking 5-HT7 receptors to neuropsychiatric disorders?

Multiple lines of evidence implicate 5-HT7 receptors in the pathophysiology of various neuropsychiatric disorders. Genomic studies in humans have suggested a link between variants in the gene encoding the 5-HT7 receptor and alcoholism, indicating a potential role in addiction processes . More directly, linkage disequilibrium mapping and case-control association analysis in Japanese schizophrenia patients identified significant associations between specific haplotype-tagging SNPs in the human 5-HT7 receptor gene (HTR7) and schizophrenia . Two specific SNPs (SNP2 and SNP5) and particular haplotypes were found to be associated with the disorder, although functional studies of a promoter SNP (SNP2) did not reveal obvious effects on gene expression . These findings support the hypothesis that HTR7 may represent a susceptibility gene for schizophrenia, at least in certain ethnic groups .

From a functional perspective, 5-HT7 receptors play important roles in modulating hippocampal neuronal functions, including learning and memory processes, disturbances of which are thought to be fundamental in schizophrenia . Studies with 5-HT7 receptor knockout mice have demonstrated specific impairments in contextual fear conditioning (associated with hippocampus-dependent learning) and reduced capacity for long-term potentiation in the CA1 region of the hippocampus . Given its involvement in these cognitive processes and the preliminary genetic associations, the 5-HT7 receptor represents a promising target for investigating the neurobiological basis of schizophrenia and potentially other neuropsychiatric conditions.

How can researchers address species differences when translating findings between rat and human 5-HT7 receptors?

When translating research findings between rat and human 5-HT7 receptors, researchers must systematically address several key species differences:

  • Isoform expression patterns: Unlike in rats where 5-HT7a predominates across brain regions, human tissues show different isoform distribution patterns . Researchers should characterize isoform-specific expression in both species for any brain region or tissue under investigation.

  • Pharmacological variations: Binding studies reveal that rat 5-HT7 receptors often display higher affinity for ligands compared to human receptors, with differences sometimes approaching 1 log unit (as observed with methiothepin) . Comprehensive comparative pharmacology studies should establish species-specific dose-response relationships for key compounds.

  • Experimental design strategies:

    • Employ parallel assays in both species when possible, using identical methodologies

    • Include species-specific positive controls in signaling studies

    • Consider humanized rat models for translational studies

    • Validate findings across multiple cell types and experimental systems

  • Molecular approaches: When feasible, conduct site-directed mutagenesis studies to identify specific amino acid residues responsible for species-dependent pharmacological differences .

  • Computational modeling: Implement molecular dynamics simulations and homology modeling to predict structural determinants of species differences in ligand binding and receptor activation.

By systematically addressing these considerations, researchers can develop more reliable translational paradigms that account for species-specific variations while maximizing the predictive value of rat-based studies for human applications.

What are the challenges and solutions for studying 5-HT7 receptor interactions with other neurotransmitter systems?

Studying 5-HT7 receptor interactions with other neurotransmitter systems presents several significant challenges along with potential methodological solutions:

Challenges:

  • Overlapping expression patterns: 5-HT7 receptors are co-expressed with multiple other receptor types in many brain regions, complicating the isolation of specific interactions .

  • Shared second messenger systems: Many receptors couple to the same signaling cascades (e.g., adenylate cyclase), making it difficult to attribute specific effects to 5-HT7 receptors .

  • Limited subtype-selective tools: Despite advances, achieving complete pharmacological isolation of 5-HT7 receptor effects remains challenging .

  • Complex temporal dynamics: Interactions may be time-dependent, requiring sophisticated time-course analyses.

Methodological Solutions:

  • Genetic approaches:

    • Conditional knockout models targeting 5-HT7 receptors in specific neuronal populations

    • CRISPR-mediated receptor tagging to track co-localization with other receptor systems

  • Advanced imaging techniques:

    • FRET/BRET to detect physical receptor-receptor interactions

    • Multiplexed in situ hybridization to map co-expression patterns

    • Optogenetic approaches combined with electrophysiology to dissect circuit-level interactions

  • Pharmacological strategies:

    • Systematic combination studies using selective agonists/antagonists

    • Allosteric modulators that enhance receptor subtype selectivity

    • Application of biased ligands that activate specific signaling pathways

  • Computational approaches:

    • Network analysis of receptor interactions across brain regions

    • Predictive modeling of multi-receptor signaling dynamics

By implementing these complementary approaches, researchers can overcome the inherent challenges and develop more comprehensive models of how 5-HT7 receptors interact with dopaminergic, glutamatergic, GABAergic, and other neurotransmitter systems in relevant brain circuits.

What are the most promising research directions for therapeutic targeting of rat 5-HT7 receptors in neurological disorders?

Based on current understanding of 5-HT7 receptor function, several promising research directions emerge for therapeutic targeting in neurological disorders:

  • Neurodevelopmental applications: The established role of 5-HT7 receptors in promoting neurite outgrowth and axonal elongation suggests potential applications in developmental disorders . Future research should explore whether selective 5-HT7 receptor agonists like LP-211 can correct aberrant neuronal connectivity in animal models of neurodevelopmental conditions.

  • Neuroregeneration strategies: The ability of 5-HT7 receptor activation to stimulate axonal growth has significant implications for neural repair . Focused studies should investigate whether timed administration of 5-HT7 receptor agonists can enhance axonal regeneration following CNS injury or in neurodegenerative conditions.

  • Cognitive enhancement approaches: Given the involvement of 5-HT7 receptors in hippocampal function and learning processes, targeted modulation might address cognitive deficits in various disorders . Research should evaluate whether selective 5-HT7 receptor modulators can improve hippocampus-dependent learning in models of cognitive impairment.

  • Addiction treatment paradigms: Emerging evidence linking 5-HT7 receptors to reward mechanisms suggests potential applications in addiction medicine . Preclinical studies with alcohol-preferring rats indicate that targeting these receptors might reduce alcohol consumption and seeking behaviors . This avenue warrants expanded investigation with other substances of abuse.

  • Schizophrenia-focused studies: The genetic association between 5-HT7 receptor variants and schizophrenia provides rationale for therapeutic exploration . Research should determine whether 5-HT7 receptor modulation can address both positive and cognitive symptoms in validated animal models.

Advancing these research directions will require continued refinement of selective pharmacological tools, development of improved animal models, and establishment of translational biomarkers to facilitate eventual clinical applications.

How do the binding affinities of ligands compare across rat 5-HT7 receptor isoforms?

The binding affinities of various ligands across the three rat 5-HT7 receptor isoforms show remarkable consistency, despite the structural differences in their C-terminal domains. Comparative binding data from recombinant expression studies are summarized in the following table:

Ligand5-HT7a (pKi)5-HT7b (pKi)5-HT7c (pKi)Notes
5-HT8.7 ± 0.28.9 ± 0.18.8 ± 0.2Endogenous agonist
5-CT9.3 ± 0.19.2 ± 0.29.1 ± 0.2High-affinity agonist
8-OH-DPAT7.5 ± 0.27.4 ± 0.37.6 ± 0.2Partial agonist, also binds 5-HT1A
LP-2118.1 ± 0.28.2 ± 0.18.0 ± 0.3Selective agonist
SB-2699708.9 ± 0.18.8 ± 0.28.7 ± 0.2Selective antagonist
Methiothepin8.4 ± 0.38.3 ± 0.28.5 ± 0.3Non-selective antagonist

This comparative analysis demonstrates that all three isoforms display nearly identical pharmacological profiles in terms of ligand recognition and binding affinity . The consistent binding properties across isoforms suggest that the ligand binding pocket formed by the transmembrane domains is structurally conserved despite variations in the C-terminal regions . This pharmacological uniformity implies that any functional differences between isoforms likely stem from variations in post-binding events such as receptor regulation, trafficking, or coupling to different signaling components rather than from differences in ligand recognition .

What is the comparative homology of rat 5-HT7 receptor with other 5-HT receptor subtypes?

The rat 5-HT7 receptor shows varying degrees of homology with other serotonin receptor subtypes, particularly within the transmembrane domains that form the ligand binding pocket. The comparative sequence homology data reveals important evolutionary and structural relationships:

ReceptorHomology with rat 5-HT7 in transmembrane domains (%)Notes
5-HT dro156Highest homology; Drosophila serotonin receptor
5-HT1B43Moderate homology
5-HT1A40Moderately related; explains some shared pharmacology
5-HT1D43Moderate homology
5-HT1E42Moderate homology
5-HT1F42Moderate homology
5-HT2A35Lower homology; different G-protein coupling
5-HT2C34Lowest homology among compared receptors
5-HT532Low homology despite both being adenylate cyclase-coupled
5-HT644Moderate homology; also adenylate cyclase-coupled

This homology pattern has important implications for understanding receptor evolution and for drug discovery efforts. The highest homology with the Drosophila 5-HT dro1 receptor suggests an evolutionarily conserved functional role . The moderate homology with 5-HT1 family receptors explains the overlapping pharmacology with compounds like 8-OH-DPAT . The lower homology with 5-HT2 receptors correlates with their different G-protein coupling preferences (Gq vs. Gs) . Researchers designing selective ligands must consider these structural relationships, as regions of high conservation between receptor subtypes present challenges for achieving subtype selectivity .

How can researchers validate the specificity of 5-HT7 receptor-mediated effects in neuronal systems?

To establish the specificity of 5-HT7 receptor-mediated effects in neuronal systems, researchers should implement a comprehensive validation approach:

  • Pharmacological validation:

    • Agonist-antagonist studies: Apply selective 5-HT7 receptor agonist (e.g., LP-211) with and without pre-treatment or co-administration of selective antagonist (e.g., SB-269970) . Complete blockade of agonist effects by the antagonist provides strong evidence for receptor specificity.

    • Dose-response relationships: Establish concentration-dependent effects of both agonists and antagonists to confirm receptor-mediated mechanisms .

    • Multiple ligand approach: Confirm findings using structurally distinct ligands that share 5-HT7 receptor selectivity to rule out off-target effects.

  • Genetic validation:

    • Receptor knockdown/knockout: Employ siRNA-mediated knockdown or CRISPR-based knockout of 5-HT7 receptors, which should eliminate responses to selective agonists if truly receptor-mediated.

    • Rescue experiments: Re-introduce wild-type 5-HT7 receptor in knockout models to restore response, providing definitive evidence of receptor specificity.

    • Point mutations: Introduce specific mutations in key binding residues to selectively disrupt ligand binding without affecting receptor expression.

  • Signaling pathway validation:

    • Pathway inhibitors: Apply specific inhibitors of known 5-HT7 receptor signaling (e.g., PKA inhibitors, ERK inhibitors) to confirm biochemical mechanisms .

    • Second messenger measurements: Directly measure cAMP accumulation, which should increase following 5-HT7 receptor activation .

    • Temporal profiling: Establish time course of pathway activation that matches receptor activation kinetics.

This multi-level validation approach ensures that observed effects are genuinely mediated by 5-HT7 receptors rather than by off-target activities or non-specific mechanisms.

What controls and experimental design considerations are essential for recombinant rat 5-HT7 receptor studies?

When designing experiments with recombinant rat 5-HT7 receptors, researchers should implement the following controls and design considerations to ensure robust and reproducible results:

  • Expression controls:

    • Empty vector controls: Include cells transfected with empty expression vector to control for transfection effects.

    • Expression level verification: Quantify receptor expression by Western blot, radioligand binding, or fluorescent tagging to normalize for expression differences between experimental groups .

    • Surface expression confirmation: Distinguish between total receptor expression and functional surface expression using surface biotinylation or flow cytometry.

  • Pharmacological controls:

    • Positive controls: Include well-characterized reference compounds with known activity at 5-HT7 receptors (e.g., 5-HT, 5-CT) .

    • Negative controls: Test compounds with no known 5-HT7 receptor activity to establish assay specificity.

    • Selectivity controls: Compare effects across multiple receptor subtypes expressed in the same system to confirm selectivity of observed effects.

  • Signaling pathway controls:

    • Forskolin controls: For cAMP assays, include forskolin (direct adenylate cyclase activator) as a positive control .

    • Pathway inhibitors: Include specific inhibitors of relevant signaling components to confirm mechanism of action .

    • Multiple pathway readouts: Monitor several downstream effects to comprehensively characterize signaling profiles.

  • Experimental design considerations:

    • Isoform specificity: Test all three rat isoforms (5-HT7a, 5-HT7b, 5-HT7c) in parallel when investigating novel compounds or pathways .

    • Time-course studies: Include multiple time points to capture both rapid and delayed responses .

    • Concentration-response curves: Generate full concentration-response relationships rather than single-concentration experiments.

    • Replication strategy: Include both technical replicates (same experiment, multiple measurements) and biological replicates (independent transfections/cultures).

    • Blinding procedures: Implement blinded analysis to prevent unconscious bias in subjective measurements.

Implementation of these controls and design considerations maximizes experimental rigor and enhances the validity and reproducibility of findings in recombinant rat 5-HT7 receptor studies.

What emerging technologies might advance our understanding of rat 5-HT7 receptor function?

Several cutting-edge technologies hold promise for advancing our understanding of rat 5-HT7 receptor function at multiple levels of analysis:

These emerging technologies will provide unprecedented insights into 5-HT7 receptor dynamics, signaling specificity, and functional roles in neuronal circuits, potentially revealing new therapeutic opportunities.

What are the critical unresolved questions regarding rat 5-HT7 receptor biology?

Despite significant advances in 5-HT7 receptor research, several critical questions remain unresolved:

  • Isoform-specific functions:

    • What are the functional consequences of the differential C-terminal domains in the three rat 5-HT7 receptor isoforms?

    • Do the isoforms exhibit distinct patterns of subcellular localization or protein-protein interactions ?

    • Why does the expression pattern of isoforms differ so markedly between rat and human tissues, and what are the functional implications of these species differences ?

  • Signaling complexity:

    • How does 5-HT7 receptor signaling integrate with other neurotransmitter systems in specific neuronal populations?

    • What determines the coupling specificity to different downstream effectors beyond adenylate cyclase ?

    • What is the complete interactome of the 5-HT7 receptor, and how do these protein-protein interactions modulate signaling outcomes?

  • Developmental roles:

    • What is the precise developmental timeline of 5-HT7 receptor expression and function in the rat brain?

    • How does 5-HT7 receptor-mediated neurite outgrowth and axonal elongation contribute to circuit formation during development ?

    • Can developmental 5-HT7 receptor dysfunction contribute to neurodevelopmental disorders?

  • Receptor regulation:

    • What are the mechanisms controlling receptor desensitization, as observed in long-term stimulation experiments ?

    • How is 5-HT7 receptor expression regulated at transcriptional and post-transcriptional levels?

    • What epigenetic factors influence 5-HT7 receptor expression in different brain regions?

  • Therapeutic potential:

    • Can selective 5-HT7 receptor modulation provide therapeutic benefits in models of neuropsychiatric disorders ?

    • What is the optimal therapeutic strategy: agonism, antagonism, or biased signaling?

    • How can rat models be best leveraged to predict human therapeutic responses given the species differences in receptor properties ?

Addressing these unresolved questions will require integrative approaches combining molecular, cellular, and systems-level analyses with advanced technological platforms and carefully designed behavioral paradigms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.