Recombinant Rat Abhydrolase domain-containing protein 1 (Abhd1)

Shipped with Ice Packs
In Stock

Description

General Information

  • The human ABHD1 gene is located on chromosome 2p23.3 and consists of 9 exons that encode a 405 amino acid protein with a molecular weight of approximately 45 kDa .

  • ABHD1 is predicted to be a single-pass type II membrane protein, but experimental confirmation is lacking .

  • Mouse studies show ubiquitous expression of ABHD1, with the highest levels in the heart and small intestine .

  • ABHD1 lacks the HX4D motif, which is present in most ABHD proteins, suggesting it may not have acyltransferase activity .

Role in Oxidative Stress

  • Overexpression of ABHD1 in a renal cell line reduces the production of reactive oxygen species (ROS) by nicotinamide adenine dinucleotide phosphate (NADPH) oxidase .

  • Kidney ABHD1 expression is upregulated in a mouse model of oxidative stress-induced hypertension, suggesting a protective response to oxidative stress .

  • ABHD1 is upregulated in a cell model of Huntington's disease, a progressive neurodegenerative disorder, where the antioxidant Nrf2-ARE pathway is also upregulated .

Function in Diabetic Retinopathy

  • ABHD1 expression increases in the retina of patients with diabetic retinopathy (DR) and in high-glucose-treated human retinal endothelial cells (HRMECs) .

  • Inhibition of ABHD1 reduces endothelial cell proliferation and migration .

  • Endothelial cell chemotaxis is closely related to ABHD1 expression .

  • ABHD1 may facilitate intermediate filament (IF)-mediated endothelial cell chemotaxis by regulating keratin 1 (KRT1) and keratin 2 (KRT2) .

Impact on Endothelial Cell Proliferation and Migration

  • Knockdown of ABHD1 with siRNA significantly lowers the proliferation level of human umbilical vein endothelial cells (HUVECs) .

  • ABHD1 promotes the migration of HUVECs .

  • The IF-related pathway is the most repressed pathway in ABHD1-knockdown HUVECs, suggesting that IF-associated proteins may be direct or indirect targets of ABHD1 in regulating endothelial cell chemotaxis .

  • In endothelial cells with low ABHD1 expression, the expression levels of IF-related proteins KRT1 and KRT2 are significantly reduced .

Gene Expression Regulation

  • Liver ABHD1 is upregulated in mice challenged with parasitic infection .

  • ABHD1 expression in mouse liver and small intestine is significantly down-regulated by transgenic activation of Notch signaling .

  • Hippocampal ABHD1 expression is down-regulated by age and up-regulated by exercise in mice .

  • ABHD1 expression is also down-regulated in regenerative neurons in response to spinal cord injury in rats .

Potential Therapeutic Target for Diabetic Retinopathy

  • ABHD1 is elevated in DR, and it might facilitate IF-mediated endothelial cell chemotaxis by KRT1 and KRT2, potentially leading to new therapies for DR .

  • Further research is needed to explore the mechanism of ABHD1 in DR .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please specify this during your order, and we will prioritize its inclusion.
Synonyms
Abhd1; Protein ABHD1; Alpha/beta hydrolase domain-containing protein 1; Abhydrolase domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-412
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Abhd1
Target Protein Sequence
MEYLHITKMLSSSLSPQNGTWSDAISLLLALGIALYLGYYWACVPQRPRLVAGPQFLAFL EQHCPVTVETFYPTLWCFEGRLQTIFRVLLQSQPVIPYRSEVLQTPDGGQFLLDWAEQPY SSHCPDPTTQPIVLLLPGISGSSQEPYILHLVDQALKDGYRAVVFNNRGCRGEELLTHRA YCASNTEDLETVVKHIKHRYSRAPLLAVGISFGGILVLNYLARTGKAGGLVAGLTMSACW DSFETVDSLETPLNSLLFNQPLTAGLCRLVARNRKSIEKVLDVDFAIKARTIRQLDERYT SVAFGYKDCAAYYHASSPRTKVDAICTPVLCLNAADDPFSPVQALPLQAAQKSPYVALLI TARGGHIGFLEGLLPWQHCYMNRVLHQYARAVFQHSVGLPGLGALTPEDGKS
Uniprot No.

Target Background

Database Links
Protein Families
AB hydrolase superfamily, AB hydrolase 4 family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is the structure and function of Abhd1?

Abhd1 belongs to the α/β-hydrolase domain family characterized by a conserved fold structure. The human form contains a 405-residue protein with a catalytic triad similar to serine proteases . Based on structural homology with other ABHD proteins, rat Abhd1 likely functions as a hydrolase enzyme. The α/β-hydrolase fold typically consists of a central β-sheet surrounded by α-helices with the catalytic triad positioned to enable hydrolytic activity.

For experimental approaches, researchers should consider:

  • Homology modeling based on other ABHD structures

  • Site-directed mutagenesis of predicted catalytic residues

  • Enzymatic activity assays with potential lipid substrates

  • Structural studies using X-ray crystallography or cryo-EM

What is the tissue expression pattern of rat Abhd1?

Based on human ABHD1 data, this protein is predominantly expressed in testis tissue . When designing experiments with rat Abhd1, researchers should:

  • Verify expression patterns using RT-qPCR across multiple rat tissues

  • Consider western blotting or immunohistochemistry for protein-level detection

  • Select appropriate cell models derived from tissues with endogenous Abhd1 expression

  • Account for potential species-specific differences in expression patterns

How does Abhd1 compare with other ABHD family members?

Abhd1 represents one member of a diverse family of hydrolases with varying tissue expression patterns and substrate specificities. Unlike well-characterized family members such as ABHD6 (involved in endocannabinoid signaling) or ABHD12, the specific substrates for Abhd1 remain undetermined .

ABHD proteinMain expression patternMain substrates
ABHD1testisNot determined
ABHD2ubiquitous expression, liver, stomachtriacylglycerols, esters
ABHD6small intestine, duodenum, spleen, brain, brown adipose tissue, kidney, liver, skin, ovarydiacylglycerols, 1(3)-monoacylglycerols, 2-arachidonoylglycerol, lysophosphatidylinositols
ABHD12ubiquitous expression, brain2-arachidonoylglycerol, 1(3)-isomer of arachidonoylglycerol, unsaturated C20:4 monoacylglycerols, lysophosphatidylserine lipids

Methodologically, comparative analysis between family members can provide insights into potential Abhd1 functions through:

  • Sequence alignment of catalytic domains

  • Structural comparison of binding pockets

  • Evolutionary analysis across species

What expression systems are optimal for recombinant rat Abhd1 production?

When producing recombinant rat Abhd1, researchers should consider:

  • Bacterial systems (E. coli): Suitable for high yield but may require refolding protocols

  • Insect cell systems: Better for maintaining enzymatic activity and proper folding

  • Mammalian expression systems: Optimal for native post-translational modifications

Optimization strategies include:

  • Codon optimization for the selected expression system

  • Fusion tags selection (His, GST, MBP) to improve solubility and purification

  • Expression temperature and induction conditions

  • Detergent screening if membrane association is suspected

How can researchers identify potential substrates for rat Abhd1?

Substrate identification represents a significant challenge since Abhd1 substrates remain undetermined . Methodological approaches include:

  • Untargeted lipidomics comparing wild-type to Abhd1-overexpressing systems

  • Activity-based protein profiling (ABPP) using broad-spectrum serine hydrolase probes

  • Substrate screening with lipid libraries based on known substrates of related ABHD proteins

  • Computational docking studies using homology models

  • Metabolite profiling in Abhd1 knockout models

Experimental design should account for potential tissue-specific substrates, considering Abhd1's expression pattern primarily in testis.

What techniques are most effective for studying Abhd1 enzyme kinetics?

For enzymatic characterization of recombinant rat Abhd1:

  • Continuous spectrophotometric assays:

    • p-nitrophenyl ester hydrolysis (similar to ABHD14B substrates)

    • Coupled enzyme assays to detect released products

  • Discontinuous assays:

    • HPLC-based detection of substrate depletion or product formation

    • Mass spectrometry to identify reaction products from complex lipid substrates

  • Kinetic parameters to determine:

    • Km and Vmax for identified substrates

    • pH and temperature optima

    • Effects of potential inhibitors on enzyme activity

Rigorous controls must include heat-inactivated enzyme and catalytic site mutants to confirm enzyme-specific activity.

How might post-translational modifications regulate Abhd1 function?

While specific data on Abhd1 post-translational modifications (PTMs) is not available in the provided search results, researchers should consider:

  • Phosphorylation sites that may regulate activity

  • S-palmitoylation, which affects several ABHD family members (ABHD10, ABHD17A/B/C)

  • Ubiquitination patterns that might influence protein turnover

Methodological approaches include:

  • Mass spectrometry-based PTM mapping

  • Site-directed mutagenesis of predicted modification sites

  • Pharmacological inhibition of specific PTM pathways

  • In vitro enzymatic assays with and without specific modifications

What are potential approaches for developing selective Abhd1 inhibitors?

Inhibitor development strategies should consider:

  • Structure-based design:

    • Homology modeling based on related ABHD structures

    • Virtual screening of compound libraries

    • Fragment-based design targeting the catalytic site

  • High-throughput screening:

    • Fluorescence-based activity assays

    • ABPP competition assays

  • Medicinal chemistry approaches:

    • Modification of known ABHD family inhibitors (e.g., compounds targeting ABHD6)

    • Structure-activity relationship studies

  • Selectivity profiling:

    • Testing against related ABHD family members

    • Proteome-wide selectivity using competitive ABPP

What purification strategies are most effective for recombinant rat Abhd1?

Optimal purification workflows typically include:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Glutathione affinity for GST-fusion proteins

  • Intermediate purification:

    • Ion exchange chromatography based on predicted isoelectric point

    • Hydrophobic interaction chromatography

  • Polishing steps:

    • Size exclusion chromatography to remove aggregates and assess oligomeric state

    • Removal of fusion tags if necessary for activity studies

Critical factors to monitor include:

  • Protein solubility throughout purification

  • Enzymatic activity retention after each step

  • Removal of endotoxins for subsequent cellular studies

  • Protein stability during storage

How can researchers validate Abhd1 knockout or knockdown models?

For genetic manipulation studies:

  • Validation at DNA level:

    • PCR genotyping of genomic modifications

    • Sequencing to confirm target alterations

  • RNA-level validation:

    • RT-qPCR to confirm reduced transcript levels

    • RNA-seq to assess potential compensatory changes in related genes

  • Protein-level validation:

    • Western blotting with specific antibodies

    • Mass spectrometry-based proteomics

    • Activity-based protein profiling to confirm functional deletion

  • Phenotypic characterization:

    • Lipidomic analysis to identify accumulated substrates

    • Cell or organism phenotyping focused on reproductive tissues given testis expression

What cellular assays are most informative for Abhd1 functional studies?

Cell-based approaches should consider:

  • Overexpression systems:

    • Transient versus stable expression

    • Inducible systems for temporal control

    • Subcellular localization using fluorescent protein fusions

  • Functional readouts:

    • Lipidomic profiling to detect changes in potential substrate levels

    • Metabolic assays if lipid metabolism is affected

    • Cell proliferation and viability in testis-derived cell lines

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with potential partners

    • Proximity labeling methods (BioID, APEX)

    • Yeast two-hybrid screening

How might Abhd1 function relate to reproductive biology?

Given the predominant expression of human ABHD1 in testis , researchers should consider:

  • Potential roles in:

    • Spermatogenesis and sperm maturation

    • Testicular lipid metabolism

    • Steroidogenesis pathways

  • Experimental approaches:

    • Immunohistochemical localization in testicular cell types

    • Temporal expression analysis during sexual development

    • Functional studies in testicular cell lines

    • Fertility assessments in knockout models

  • Comparative analysis:

    • Differences in expression and function between species

    • Evolutionary conservation of testis expression

What are potential connections between Abhd1 and lipid-related diseases?

While specific disease associations for Abhd1 aren't documented in the provided search results, researchers studying lipid-related pathologies should consider:

  • Investigation approaches:

    • Expression analysis in disease models relevant to testicular pathology

    • Genetic association studies linking Abhd1 variants to disease phenotypes

    • Metabolomic profiling in normal versus disease states

  • Potential disease contexts:

    • Male infertility conditions

    • Testicular cancers

    • Metabolic disorders affecting reproductive function

  • Therapeutic implications:

    • If substrate identification reveals relevant lipid signaling pathways

    • Possible development of Abhd1 modulators using approaches similar to those used for other ABHD family inhibitors

How conserved is Abhd1 structure and function across species?

Understanding evolutionary conservation provides important context:

  • Sequence analysis approaches:

    • Multiple sequence alignment across mammals

    • Conservation mapping onto structural models

    • Identification of invariant catalytic residues

  • Functional conservation assessment:

    • Cross-species substrate preference comparison

    • Expression pattern conservation analysis

    • Complementation studies in knockout models

  • Structural considerations:

    • Comparative modeling of rat versus human Abhd1

    • Binding site conservation analysis

    • Prediction of species-specific features

The human ABHD1 gene contains nine exons and encodes a 405-residue protein , providing a reference point for comparative studies with the rat ortholog.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.