Recombinant Rat Acetylcholine receptor subunit epsilon (Chrne)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Chrne encodes the ε-subunit of the muscle-type AChR, which assembles with α-, β-, and δ-subunits to form adult AChRs (α₂βδε) . Key roles include:

  • Neuromuscular Transmission: Facilitates ion channel opening upon acetylcholine binding, enabling muscle depolarization .

  • Developmental Transition: Replaces the fetal γ-subunit postnatally, enhancing channel conductance and stability .

  • Disease Association: Mutations in CHRNE cause congenital myasthenic syndromes (CMS) due to impaired AChR function .

Production and Recombinant Expression

Recombinant Rat Chrne is produced using E. coli expression systems for research applications :

Key Production Data:

ParameterDetails
Expression SystemE. coli (in vitro)
TagN-terminal 10×His-tag for purification
ImmunogenRecombinant fragment (Human CHRNE aa 1–250)
Storage–20°C (short-term); –80°C (long-term); avoid repeated freeze-thaw cycles

A. Disease Modeling

  • Congenital Myasthenic Syndromes (CMS): Over 90 CHRNE mutations linked to CMS alter AChR kinetics (e.g., slow-channel or fast-channel syndromes) . Recombinant ε-subunits enable functional studies of mutations like εS276N or εI277V .

  • Autoimmune Myasthenia Gravis (MG): Used to study autoantibody targeting of AChRs and develop antigen-specific therapies .

B. Channel Biophysics

  • Single-Channel Recordings: Recombinant ε-subunits reveal spontaneous channel openings in ancestral β-subunit homopentamers, highlighting evolutionary conservation of gating mechanisms .

  • Agonist Binding: ε-subunit contributes to ligand-binding interfaces (α–ε site) with higher acetylcholine affinity than fetal γ-subunits .

Table 1: Functional Insights from Recombinant Chrne Studies

StudyMethodKey FindingReference
AChR ClusteringLive imaging (C2C12)Neuregulin-1 enhances agrin-induced AChR cluster size by 40% in embryonic muscle .
Channel ConductanceXenopus oocyte assaysε-subunit M2 domain residues (S276, I277) increase conductance by 20% vs. γ-subunit .
CMS MutationsElectrophysiologyεL221F mutation reduces AChR expression by 70%, causing severe CMS .

Future Directions

  • Therapeutic Development: Engineered ε-subunits are being tested for antigen-specific tolerance in MG .

  • Evolutionary Studies: Ancestral β-subunit homopentamers provide insights into AChR evolution .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Chrne; Achre; Acetylcholine receptor subunit epsilon
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-494
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Chrne
Target Protein Sequence
KNEELSLYHHLFDNYDPECRPVRRPEDTVTITLKVTLTNLISLNEKEETLTTSVWIGIEW QDYRLNFSKDDFAGVEILRVPSEHVWLPEIVLENNIDGQFGVAYDCNVLVYEGGSVSWLP PAIYRSTCAVEVTYFPFDWQNCSLIFRSQTYNAEEVELIFAVDDDGNAINKIDIDTAAFT ENGEWAIDYCPGMIRHYEGGSTEDPGETDVIYTLIIRRKPLFYVINIIVPCVLISGLVLL AYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLSVPLLGRYLIFVMVVATLIVM NCVIVLNVSLRTPTTHATSPRLRQILLELLPRLLGLSPPPEDPGAASPARRASSVGILLR AEELILKKPRSELVFEGQRHRHGTWTAAALCQNLGAAAPEVRCCVDAVNFVAESTRDQEA TGEELSDWVRMGKALDNVCFWAALVLFSVGSTLIFLGGYFNQVPDLPYPPCIQP
Uniprot No.

Target Background

Function

Upon acetylcholine binding, the AChR undergoes a significant conformational change affecting all subunits. This change results in the opening of an ion channel across the plasma membrane.

Database Links
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Epsilon/CHRNE sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular weight and structure of recombinant rat Chrne protein?

Recombinant rat acetylcholine receptor subunit epsilon (Chrne) has an expected molecular weight of approximately 50.1 kDa, though the predicted band size in Western blot applications is around 54 kDa . The protein forms part of the pentameric nicotinic acetylcholine receptor (nAChR) complex, which undergoes extensive conformational changes upon acetylcholine binding. These changes affect all subunits and lead to the opening of an ion-conducting channel across the plasma membrane .

The epsilon subunit contains several key functional domains, including:

  • Extracellular N-terminal domain containing the ligand-binding site

  • Four transmembrane domains (M1-M4)

  • A large intracellular loop between M3 and M4

  • A short extracellular C-terminal domain

What expression systems are most reliable for producing functional rat Chrne?

For successful expression of functional recombinant rat Chrne, researchers should consider the following expression systems:

  • Mammalian cell lines: HEK293 and CHO cells provide proper post-translational modifications and are widely used for functional studies. When expressing in these systems, co-transfection with other nAChR subunits (α, β, δ) in specific ratios (typically 2:1:1:1 for α:β:δ:ε) is necessary for pentameric receptor assembly .

  • Xenopus oocytes: Ideal for electrophysiological studies of assembled receptors, allowing functional characterization through two-electrode voltage clamp recordings.

  • Insect cell systems: Sf9 or High Five cells using baculovirus expression systems may provide higher protein yields, though functionality must be carefully verified.

Methodological considerations for optimizing expression include:

  • Codon optimization for the host system

  • Use of strong promoters (CMV for mammalian cells)

  • Addition of signal sequences to ensure proper trafficking

  • Temperature reduction during expression (30-32°C) to enhance folding

  • Addition of chaperones to improve assembly

How can you confirm successful expression and functionality of recombinant rat Chrne?

Verification of successful expression involves multiple complementary approaches:

  • Western blot analysis: Using specific antibodies such as mouse monoclonal anti-Chrne antibodies at 1/500 dilution, which can detect the protein at the expected molecular weight (50-54 kDa) .

  • Immunocytochemistry: To verify cellular localization and trafficking.

  • Functional verification methods:

    • Patch-clamp electrophysiology to assess channel function

    • Calcium imaging following stimulation with acetylcholine

    • Radioligand binding assays using labeled α-bungarotoxin or other nAChR ligands

    • Fluorescence-based membrane potential assays

  • Co-immunoprecipitation: To verify assembly with other receptor subunits.

When assessing functionality, researchers should test both agonist-induced responses (using acetylcholine) and antagonist blockade (using d-tubocurarine or α-bungarotoxin) to confirm specificity.

What key residues in rat Chrne determine binding specificity and functionality?

Several critical residues in the rat Chrne subunit have been identified that determine binding specificity and functionality:

ResiduePositionFunctional Significance
Glycine57Critical for binding site selectivity
Aspartic acid59Involved in ligand binding specificity
Tyrosine111Contributes to high-affinity binding
Tyrosine115Contributes to high-affinity binding
Aspartic acid173Required for binding selectivity, particularly with Wtx-1

Research has shown that these residues are particularly important in determining binding selectivity for Waglerin-1 (Wtx-1), a peptide antagonist that binds to the alpha-epsilon binding site with significantly higher affinity than to the alpha-delta binding site . Specifically, residues Gly-57, Asp-59, Tyr-111, Tyr-115, and Asp-173 of the epsilon subunit account predominantly for the 3700-fold higher affinity of the alpha-epsilon site compared to the alpha-gamma site .

What antibodies and detection methods are recommended for rat Chrne research?

For reliable detection of rat Chrne in research applications, consider these validated approaches:

  • Recommended antibodies:

    • Mouse monoclonal anti-Nicotinic Acetylcholine Receptor epsilon/CHRNE antibody (clone 4E10F6) has been validated for Western blot applications in rat samples and recombinant human protein .

    • Optimal dilution for Western blot: 1/500 .

  • Detection methods by application:

    • Western blot: Use standard SDS-PAGE with transfer to PVDF membranes. Expected molecular weight is 50.1 kDa, with predicted band size around 54 kDa .

    • Immunohistochemistry: Fixation with 4% paraformaldehyde followed by permeabilization with 0.1% Triton X-100 is recommended for most applications.

    • Flow cytometry: For cell surface expression studies in transfected cells.

  • Considerations for specificity:

    • Always include positive controls (recombinant Chrne protein)

    • Use knockout/knockdown samples as negative controls when possible

    • Consider cross-reactivity with other acetylcholine receptor subunits

What electrophysiological approaches are most effective for studying rat Chrne function?

Electrophysiological approaches remain the gold standard for functional characterization of rat Chrne-containing receptors:

How do mutations in rat Chrne affect acetylcholine receptor function?

Mutations in rat Chrne can significantly impact acetylcholine receptor function through various mechanisms:

  • Effect on receptor assembly and trafficking:

    • Some mutations prevent proper subunit folding and assembly

    • Others allow assembly but impair trafficking to the cell surface

    • Quantification of surface expression using biotinylation assays or flow cytometry is essential for distinguishing these mechanisms

  • Alterations in channel kinetics:

    • Mutations may affect channel opening probability

    • Changes in mean open time

    • Altered desensitization rates

    • Modified conductance properties

  • Ligand binding properties:

    • Reduced acetylcholine binding affinity

    • Altered sensitivity to competitive antagonists

    • Changes in binding site selectivity, particularly at the alpha-epsilon interface

  • Methodological approach to studying mutations:

    • Site-directed mutagenesis of recombinant Chrne

    • Electrophysiological characterization

    • Ligand binding assays

    • Protein trafficking studies

    • Structural modeling based on homologous proteins

  • Disease-relevant mutations:

    • Mutations in human CHRNE cause congenital myasthenic syndromes (CMS)

    • Rat models carrying equivalent mutations can help understand pathophysiology

    • These models can be used to test potential therapeutic approaches

What binding assays are most sensitive for studying ligand interactions with rat Chrne?

Several binding assay approaches offer different advantages for studying ligand interactions with rat Chrne:

  • Radioligand binding assays:

    • [125I]-α-bungarotoxin binding to measure binding site occupancy

    • [3H]-acetylcholine for direct agonist binding studies

    • Saturation binding to determine Bmax and Kd values

    • Competition binding to determine affinity of unlabeled compounds

  • Fluorescence-based methods:

    • FRET-based binding assays using labeled ligands

    • Fluorescently-labeled α-bungarotoxin for binding site visualization

    • Flow cytometry for quantifying binding to cell-surface receptors

  • Surface plasmon resonance (SPR):

    • Real-time binding kinetics (kon/koff)

    • Label-free detection of binding events

    • Requires purified receptor protein or receptor-rich membrane preparations

  • Isothermal titration calorimetry (ITC):

    • Provides complete thermodynamic profile (ΔH, ΔS, ΔG)

    • Label-free approach for studying binding energetics

    • Requires relatively large amounts of purified protein

  • Computational approaches:

    • Molecular docking simulations based on homology models

    • Molecular dynamics simulations to predict binding modes

    • Virtual screening for novel ligands

When studying specific binding sites, such as the alpha-epsilon interface, researchers should consider designing experiments to distinguish binding to different interfaces within the pentameric receptor, as demonstrated in studies with Waglerin-1 that selectively binds to the alpha-epsilon site with significantly higher affinity than to the alpha-delta site .

How can rat Chrne models be used to study congenital myasthenic syndromes?

Rat Chrne models provide valuable insights into congenital myasthenic syndromes (CMS) through several approaches:

  • Generation of disease-relevant models:

    • CRISPR-Cas9 engineering of specific mutations identified in human CMS

    • Knockdown/knockout models to study loss-of-function effects

    • Transgenic expression of mutant Chrne

  • Functional characterization:

    • Electrophysiological analysis of neuromuscular junction (NMJ) transmission

    • End-plate potential recordings

    • Single-channel analysis of mutant receptors

    • Muscle force generation and fatigability testing

  • Pharmacological testing:

    • Assessment of response to acetylcholinesterase inhibitors

    • Evaluation of β2-adrenergic receptor agonists, which have shown the best treatment effect for CMS patients with CHRNE mutations

    • Screening of novel therapeutic compounds

  • Structural and molecular analysis:

    • Quantification of receptor density at NMJs

    • Analysis of receptor turnover and half-life

    • Evaluation of compensatory mechanisms

    • Protein-protein interaction changes

  • Systematic literature analysis approaches:
    Meta-analyses of treatment responses can help identify optimal therapeutic strategies. For example, research has found that β2-adrenergic receptor agonists had the best treatment effect for CMS patients with CHRNE mutations, especially in patients with primary mutations .

Treatment StrategyEffectiveness in CHRNE MutationsNotes
β2-adrenergic receptor agonists+++ (Best response)Particularly effective in primary mutations
Acetylcholinesterase inhibitors++Standard first-line therapy
3,4-diaminopyridine+Often used in combination therapy
Ephedrine++Alternative sympathomimetic

What are the best approaches for studying rat Chrne protein-protein interactions?

Investigating protein-protein interactions involving rat Chrne requires specialized techniques:

  • Co-immunoprecipitation (Co-IP):

    • Pull-down of Chrne using specific antibodies followed by detection of interacting partners

    • Reverse Co-IP pulling down suspected binding partners

    • Use of cross-linking agents to stabilize transient interactions

  • Proximity labeling approaches:

    • BioID or TurboID fusion to Chrne to biotinylate proximal proteins

    • APEX2 fusion for proximity-based biotinylation

    • Analysis of labeled proteins by mass spectrometry

  • Fluorescence-based interaction assays:

    • FRET between fluorescently tagged Chrne and binding partners

    • Bimolecular Fluorescence Complementation (BiFC)

    • Fluorescence Recovery After Photobleaching (FRAP) to study dynamics

  • Mass spectrometry-based approaches:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify conformational changes

  • Structural studies of interactions:

    • Cryo-electron microscopy of assembled receptors

    • X-ray crystallography of binding domains

    • NMR spectroscopy for smaller domains and complexes

When studying interactions between Chrne and other acetylcholine receptor subunits, researchers should consider the specific binding interfaces and how mutations affect these interactions. Studies on Waglerin-1 binding have identified key residues in the epsilon subunit (Gly-57, Asp-59, Tyr-111, Tyr-115, and Asp-173) that determine binding selectivity at the alpha-epsilon interface .

How can CRISPR-Cas9 be used to engineer rat Chrne mutations for functional studies?

CRISPR-Cas9 technology offers powerful approaches for engineering rat Chrne mutations:

  • Design strategy for gene editing:

    • gRNA selection: Design guide RNAs targeting specific exons of the Chrne gene. Multiple gRNA design tools can predict off-target effects and efficiency.

    • Donor template design: For homology-directed repair (HDR), design donor templates with 800-1000bp homology arms flanking the desired mutation.

    • Mutation types: Consider introducing point mutations, deletions, insertions, or domain swaps depending on research question.

  • Delivery methods for rat models:

    • Cell line models: Transfection or electroporation of CRISPR components into rat myoblast cell lines.

    • Primary cell models: Nucleofection of primary rat muscle cells.

    • In vivo models: Pronuclear injection for germline editing or in situ electroporation for tissue-specific editing.

  • Verification of successful editing:

    • Genomic verification: PCR amplification followed by Sanger sequencing or next-generation sequencing.

    • Functional verification: Western blot, immunostaining, and functional assays as described in previous sections.

    • Off-target analysis: Targeted sequencing of predicted off-target sites or whole-genome sequencing for comprehensive assessment.

  • Advantages of genome editing over traditional approaches:

    • Generation of isogenic control lines differing only in the Chrne mutation

    • Ability to introduce complex mutations or domain swaps

    • Opportunity to study mutations in their native genomic context

  • Applications to disease modeling:

    • Introduction of specific CMS-causing mutations identified in humans

    • Creation of reporter lines for high-throughput drug screening

    • Development of humanized rat models by replacing rat Chrne with human CHRNE

When designing CRISPR experiments, researchers should take advantage of the improved rat reference genome (mRatBN7.2), which provides better mapping precision for genomic data and more complete gene annotations compared to previous assemblies .

What computational methods help predict functional effects of rat Chrne mutations?

Computational approaches offer valuable insights into the potential functional consequences of Chrne mutations:

  • Sequence-based prediction methods:

    • Conservation analysis: Multiple sequence alignment across species to identify evolutionary conserved residues

    • Machine learning algorithms: SIFT, PolyPhen-2, and PROVEAN for predicting pathogenicity

    • Statistical coupling analysis: To identify co-evolving residues indicating functional relationships

  • Structure-based approaches:

    • Homology modeling: Building 3D models based on related structures from other species

    • Molecular dynamics simulations: To assess structural stability and conformational changes

    • Molecular docking: Predicting binding modes of ligands to wild-type and mutant receptors

    • Free energy calculations: Calculating changes in binding energy for mutations

  • Systems biology approaches:

    • Protein-protein interaction network analysis: Predicting effects on interactome

    • Gene regulatory network modeling: Understanding transcriptional consequences

    • Pathway analysis: Identifying affected signaling pathways

  • Integration with experimental data:

    • Functional validation pipelines: Using computational predictions to guide experimental design

    • Machine learning integration: Combining computational predictions with experimental data for improved accuracy

  • Resources specifically for nAChR research:

    • LGICdb: Database of ligand-gated ion channels

    • Channelpedia: Repository of ion channel information

    • CMS database: Compilation of CMS-causing mutations and phenotypes

Computational MethodApplicationAdvantagesLimitations
Homology modeling3D structure predictionProvides structural context for mutationsAccuracy depends on template quality
Molecular dynamicsConformational analysisCaptures dynamic behaviorComputationally intensive
Machine learning predictionPathogenicity assessmentFast, high-throughputMay miss novel mechanisms
Network analysisSystem-level effectsCaptures indirect effectsRequires comprehensive interaction data

How can single-molecule imaging be applied to study rat Chrne dynamics?

Single-molecule imaging techniques provide unprecedented insights into the dynamics of Chrne:

  • Labeling strategies for single-molecule visualization:

    • Fusion proteins: GFP, mEos, or HaloTag fusions to Chrne

    • Site-specific labeling: SNAP-tag, CLIP-tag for pulse-chase experiments

    • Antibody-based labeling: Using Fab fragments conjugated to fluorophores

    • Quantum dots: For long-term tracking with reduced photobleaching

  • Single-molecule techniques applicable to Chrne research:

    • Single-particle tracking (SPT): Monitoring receptor diffusion in the membrane

    • Single-molecule FRET (smFRET): Detecting conformational changes upon ligand binding

    • Super-resolution microscopy: PALM, STORM, or STED for nanoscale localization

    • Single-molecule pull-down (SiMPull): Analyzing subunit stoichiometry

  • Key biological questions addressable with these approaches:

    • Receptor assembly: How do subunits come together to form functional pentamers?

    • Trafficking dynamics: What is the pathway from synthesis to membrane insertion?

    • Clustering behavior: How do receptors cluster at the neuromuscular junction?

    • Conformational dynamics: What are the real-time structural changes during gating?

  • Technical considerations for successful experiments:

    • Labeling density: Must be sufficiently sparse for single-molecule resolution

    • Photobleaching control: Oxygen scavenging systems to extend fluorophore lifetime

    • Drift correction: Fiducial markers for long-term imaging

    • Analysis software: Specialized tracking algorithms for trajectory analysis

  • Integration with functional studies:

    • Correlating mobility with channel function through simultaneous electrophysiology

    • Tracking receptor internalization following pharmacological manipulation

    • Assessing effects of disease-causing mutations on receptor dynamics

What approaches are recommended for studying post-translational modifications of rat Chrne?

Post-translational modifications (PTMs) of rat Chrne significantly impact its function and can be studied through:

  • Mass spectrometry-based PTM identification:

    • Sample preparation: Immunoprecipitation of Chrne followed by enzymatic digestion

    • Enrichment strategies: Phosphopeptide enrichment (TiO2, IMAC), glycopeptide enrichment (lectin affinity)

    • MS analysis: High-resolution MS/MS for comprehensive PTM mapping

    • Quantitative approaches: SILAC, TMT, or label-free quantification for comparative studies

  • Site-specific PTM analysis:

    • Phosphorylation: Western blotting with phospho-specific antibodies

    • Glycosylation: Lectin blotting, PNGase F treatment

    • Palmitoylation: Acyl-biotin exchange assay, click chemistry approaches

    • Ubiquitination: Ubiquitin pulldown assays

  • Functional consequences of PTMs:

    • Mutagenesis approach: Mutation of modification sites to non-modifiable residues

    • Phosphomimetic mutations: Replacement with Asp/Glu to mimic phosphorylation

    • Pharmacological manipulation: Kinase inhibitors, glycosylation inhibitors

    • Functional readouts: Trafficking assays, electrophysiology, binding studies

  • PTM crosstalk analysis:

    • Sequential immunoprecipitation: To identify proteins with multiple modifications

    • Multiplexed PTM analysis: Using advanced MS approaches

    • Computational modeling: To predict interactions between different PTMs

  • Disease relevance of PTMs:

    • Altered PTM patterns: In disease models or patient samples

    • Therapeutic targeting: Modulating enzymes responsible for Chrne modifications

    • Biomarker potential: Of specific PTM signatures

PTM TypeCommon SitesFunctional ImpactDetection Methods
PhosphorylationSer, Thr, TyrModulates gating, desensitizationPhospho-specific antibodies, MS
N-glycosylationAsn in N-X-S/T motifsAffects trafficking and stabilityPNGase F treatment, lectin blotting
PalmitoylationCys residuesMembrane anchoring, localizationAcyl-biotin exchange, click chemistry
UbiquitinationLys residuesTargets for degradationUbiquitin pulldown, MS

How can rat Chrne be incorporated into artificial membrane systems for functional studies?

Artificial membrane systems offer controlled environments for studying rat Chrne function:

  • Liposome reconstitution:

    • Protein preparation: Detergent solubilization and purification of recombinant Chrne-containing receptors

    • Liposome formation: Using defined lipid compositions (typically PC/PE/cholesterol mixtures)

    • Reconstitution methods: Detergent removal by dialysis, Bio-Beads, or gel filtration

    • Functional assays: Ion flux assays using fluorescent dyes or radioactive tracers

  • Planar lipid bilayers:

    • Bilayer formation: Painting or folding methods across apertures

    • Protein incorporation: Direct addition of purified receptors or vesicle fusion

    • Electrophysiological recording: Single or multiple channel recordings

    • Advantages: Precise control of solutions on both sides of membrane

  • Nanodiscs technology:

    • Assembly: Co-assembly of purified receptors with membrane scaffold proteins and lipids

    • Size control: Different scaffold proteins for various disc diameters

    • Applications: Structural studies, binding assays, limited functional studies

    • Advantages: Stable, monodisperse samples suitable for structural biology

  • Droplet interface bilayers (DIBs):

    • Formation: Creating bilayers between aqueous droplets in oil

    • Throughput: Potential for array formats and parallelization

    • Measurements: Electrical recordings across bilayers

    • Applications: High-throughput screening of channel modulators

  • Supported lipid bilayers:

    • Preparation: Vesicle fusion on solid supports (glass, mica)

    • Characterization: AFM, TIRF microscopy, SPR

    • Applications: Lateral mobility studies, binding assays

    • Advanced approaches: Cushioned bilayers to accommodate transmembrane proteins

When developing artificial membrane systems for Chrne studies, researchers should consider the importance of specific lipid compositions and cholesterol content, as these factors significantly affect acetylcholine receptor function. Additionally, co-reconstitution with other receptor subunits in appropriate ratios is essential for forming functional pentameric channels.

What therapeutic strategies target rat Chrne in neuromuscular disease models?

Therapeutic approaches targeting rat Chrne in neuromuscular disease models encompass several strategies:

  • Pharmacological modulation:

    • Acetylcholinesterase inhibitors: Enhance synaptic acetylcholine levels

    • Direct receptor modulators: Positive allosteric modulators to enhance channel opening

    • β2-adrenergic receptor agonists: Shown to have the best treatment effect for CMS patients with CHRNE mutations

    • 3,4-diaminopyridine: Potassium channel blockers that enhance acetylcholine release

  • Gene therapy approaches:

    • Gene replacement: Delivery of wild-type Chrne using viral vectors

    • Antisense oligonucleotides: For splice-modulating therapy in specific mutations

    • RNA editing: CRISPR-Cas13 or Adenosine Deaminase Acting on RNA (ADAR) approaches

    • Readthrough therapy: For nonsense mutations

  • Protein-targeted approaches:

    • Chemical chaperones: To improve folding of mutant receptors

    • Proteasome inhibitors: To reduce degradation of partially functional receptors

    • Trafficking enhancers: To increase cell surface expression

  • Cell-based therapies:

    • Muscle progenitor cell transplantation: With corrected Chrne expression

    • Stem cell approaches: Differentiated to form functional neuromuscular junctions

  • Efficacy assessment methods:

    • Electrophysiological readouts: Compound muscle action potentials, miniature end-plate potentials

    • Functional tests: Grip strength, hanging wire test, rotarod performance

    • Biochemical markers: Receptor density quantification, turnover rate

    • Quality of life measures: For translational relevance

Research has indicated that β2-adrenergic receptor agonists showed the best treatment effect for CMS patients with CHRNE mutations, particularly in patients with primary mutations . This highlights the importance of precisely characterizing mutations to guide treatment selection.

How do different agonists and antagonists compare in their effects on rat Chrne-containing receptors?

Comparative pharmacology of agonists and antagonists on rat Chrne-containing receptors reveals important differences:

  • Agonist comparative profiles:

    • Acetylcholine (endogenous): Full agonist, rapid desensitization

    • Nicotine: Partial agonist, slower desensitization rate

    • Carbachol: More resistant to acetylcholinesterase, longer duration

    • Choline: Low-efficacy agonist, selective for some receptor subtypes

    • Epibatidine: High-potency agonist, significant cross-reactivity with neuronal nAChRs

  • Antagonist selectivity patterns:

    • α-Bungarotoxin: High affinity, virtually irreversible binding

    • d-Tubocurarine: Competitive antagonist, moderate affinity

    • Waglerin-1: Selective for the alpha-epsilon binding site with significantly higher affinity than for the alpha-delta binding site

    • Pancuronium: Non-depolarizing antagonist used clinically

    • Conotoxins: Family of peptide toxins with various selectivity profiles

  • Structure-activity relationships:

    • Binding site selectivity: Key residues in the epsilon subunit (Gly-57, Asp-59, Tyr-111, Tyr-115, and Asp-173) determine binding selectivity, particularly for Waglerin-1

    • Species differences: Variations in binding profiles between rat and human receptors

    • Subunit interface targeting: Compounds that selectively target alpha-epsilon vs. alpha-delta interfaces

  • Quantitative pharmacological parameters:

    CompoundReceptor SubtypeEC50/IC50EfficacyBinding Site
    Acetylcholine(α)2βδε10-30 μMFull agonistα-δ, α-ε interfaces
    Nicotine(α)2βδε0.5-10 μMPartial agonistα-δ, α-ε interfaces
    Waglerin-1(α)2βδε10-50 nMAntagonistSelective for α-ε interface
    α-Bungarotoxin(α)2βδε0.1-1 nMAntagonistα subunit
  • Allosteric modulators:

    • Positive allosteric modulators: Enhance channel opening or reduce desensitization

    • Negative allosteric modulators: Reduce channel opening probability

    • Binding sites: Distinct from orthosteric (acetylcholine) binding site

How can cutting-edge genomic technologies advance rat Chrne research?

Advanced genomic technologies are transforming rat Chrne research:

  • Next-generation sequencing applications:

    • RNA-seq: Transcriptional profiling before and after receptor activation

    • ATAC-seq: Identifying regulatory elements controlling Chrne expression

    • ChIP-seq: Mapping transcription factor binding sites in the Chrne locus

    • Long-read sequencing: For complex structural variants affecting Chrne

  • Single-cell genomic approaches:

    • scRNA-seq: Heterogeneity in Chrne expression across muscle cells

    • Spatial transcriptomics: Localized expression patterns at neuromuscular junctions

    • Multi-omics integration: Combining transcriptomic and proteomic data

    • Lineage tracing: Developmental regulation of Chrne expression

  • Genome editing beyond CRISPR-Cas9:

    • Base editors: For precise C→T or A→G conversions without double-strand breaks

    • Prime editing: For small insertions, deletions, and all possible point mutations

    • Epigenome editing: Modulating Chrne expression without changing sequence

    • In vivo delivery methods: AAV-based or lipid nanoparticle approaches

  • Benefits of improved rat reference genome:

    • The new mRatBN7.2 assembly offers significant improvements over previous versions:

      • 9-fold reduction in base-level errors

      • 290-fold increase in contiguity

      • More complete gene annotations

      • Better mapping precision for genomic, transcriptomic, and proteomics data

  • Integration with other -omics data:

    • Proteomics: Post-translational modifications and protein-protein interactions

    • Metabolomics: Changes in metabolic profiles following receptor activation

    • Systems biology approaches: Network-level understanding of Chrne function

When designing genomic studies, researchers should take advantage of the improved rat reference genome (mRatBN7.2), which provides better mapping precision for genomic data and more complete gene annotations compared to previous assemblies .

What are the emerging trends in Chrne structural biology research?

Structural biology of Chrne is advancing rapidly with several emerging approaches:

Ancestral protein reconstruction approaches have yielded valuable insights into acetylcholine receptor evolution and function. Research has shown that a reconstructed ancestral muscle-type β-subunit can form homopentameric ion channels that open spontaneously , providing new perspectives on receptor assembly and gating mechanisms.

How can rat Chrne research inform personalized medicine approaches for myasthenic syndromes?

Rat Chrne research provides critical insights for personalized medicine in myasthenic syndromes:

  • Mutation-specific treatment strategies:

    • Pharmacogenomic correlations: Linking specific mutations to optimal drug responses

    • Precision therapy selection: Research has shown that β2-adrenergic receptor agonists had the best treatment effect for CMS patients with CHRNE mutations

    • Drug repurposing opportunities: Testing approved drugs for efficacy in specific mutations

    • Combination therapy optimization: Based on underlying molecular mechanisms

  • Biomarker development:

    • Electrophysiological signatures: Distinctive patterns for different mutation types

    • Circulating biomarkers: Extracellular vesicles containing Chrne fragments

    • Imaging biomarkers: Receptor density and distribution at NMJs

    • Response prediction: Early markers of treatment efficacy

  • Patient stratification approaches:

    • Functional classification: Based on receptor expression, assembly, and gating properties

    • Computational prediction: Machine learning algorithms to predict mutation effects

    • Ex vivo testing: Patient-derived cell models for personalized drug screening

    • Natural history studies: Correlating genotype with disease progression

  • Translational research pipelines:

    • High-throughput screening: Using rat models with human-equivalent mutations

    • Patient-derived xenografts: For in vivo testing of personalized approaches

    • Organ-on-chip models: Neuromuscular junction microfluidic systems

    • Reverse translation: From clinical observations back to mechanistic studies

  • Ethical and practical considerations:

    • Rare disease challenges: Limited patient populations for clinical studies

    • Genetic counseling implications: For hereditary CMS

    • Cost-effectiveness analysis: Of personalized treatment approaches

    • Implementation science: Bringing precision medicine to clinical practice

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.