Recombinant Rat Acyl-CoA desaturase 1 (Scd1)

Shipped with Ice Packs
In Stock

Description

SCD1 activity is tightly linked to energy metabolism:

  • Lipid Homeostasis: Overexpression of SCD1 in cardiac myocytes increased lipid accumulation by 3.6-fold but reduced mitochondrial ROS and apoptosis induced by SFAs .

  • Insulin Sensitivity: Knockdown of hepatic SCD1 via antisense oligonucleotides (ASOs) reversed diet-induced insulin resistance in rats and mice, restoring glucose oxidation and suppressing gluconeogenic enzymes (e.g., PEPCK and Glc-6-Pase) .

  • Energy Substrate Shift: SCD1 shifts cardiac metabolism from fatty acid oxidation to glucose utilization under high-SFA conditions, mitigating lipotoxicity .

Cardioprotective Effects

In rat models of metabolic syndrome induced by high-sucrose diets:

  • SCD1 expression increased 3.6-fold in the heart, correlating with reduced caspase-3 activation (−70%) and ceramide synthesis (−50%) .

  • SCD1 overexpression attenuated palmitic acid–induced apoptosis by lowering mitochondrial ROS and diacylglycerol (DAG) accumulation .

Hepatic Insulin Resistance

  • High-fat diet–fed mice treated with SCD1 ASOs showed normalized hepatic glucose production and enhanced Akt phosphorylation .

  • Hepatic SCD1 deficiency reduced plasma triglycerides (−30%) but increased intrahepatic lipid content, suggesting altered lipid partitioning .

Detection and Quantification

The Rat SCD1 ELISA Kit (EK7444) is a validated tool for measuring SCD1 levels in research settings :

ParameterSpecification
Detection Range15.6–1,000 pg/mL
Sensitivity<10 pg/mL
Stability12 months at 2–8°C; 7 days at 37°C equivalent to 1 year at 2–8°C
Species ReactivityRat (Rattus norvegicus)

Therapeutic Implications

SCD1 inhibition has emerged as a strategy for metabolic disorders:

  • Obesity: SCD1-deficient mice resist diet-induced obesity due to increased energy expenditure and fatty acid oxidation .

  • Diabetes: Hepatic SCD1 knockdown improves insulin sensitivity by suppressing gluconeogenesis .

  • Cardiomyopathy: Cardiac SCD1 upregulation protects against SFA-induced lipotoxicity, suggesting tissue-specific therapeutic targeting .

Research Gaps and Future Directions

  • The precise structural determinants of SCD1’s substrate specificity remain unresolved.

  • Long-term effects of recombinant SCD1 modulation in chronic disease models are understudied.

  • Tissue-specific roles (e.g., cardiac vs. hepatic SCD1) warrant further exploration to avoid off-target effects in therapy.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Scd1; Scd; Acyl-CoA desaturase 1; Delta(9-desaturase 1; Delta-9 desaturase 1; Fatty acid desaturase 1; Stearoyl-CoA desaturase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-358
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Scd1
Target Protein Sequence
PAHMLQEISSSYTTTTTITEPPSGNLQNGREKMKKVPLYLEEDIRPEMREDIHDPSYQDE EGPPPKLEYVWRNIILMALLHVGALYGITLIPSSKVYTLLWGIFYYLISALGITAGAHRL WSHRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHV GWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETF LHSLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHH AFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAVLARIKRTGDGSHKSS
Uniprot No.

Target Background

Function

Recombinant Rat Acyl-CoA desaturase 1 (SCD1) is a stearoyl-CoA desaturase that utilizes O2 and electrons from reduced cytochrome b5 to introduce a double bond into saturated fatty acyl-CoA substrates. It catalyzes the insertion of a cis double bond at the Δ9 position in substrates such as palmitoyl-CoA and stearoyl-CoA, producing a mixture of 16:1 and 18:1 unsaturated fatty acids. SCD1 plays a crucial role in lipid biosynthesis, regulating the expression of lipogenesis genes and mitochondrial fatty acid oxidation. It significantly contributes to body energy homeostasis and the biosynthesis of membrane phospholipids, cholesterol esters, and triglycerides. Furthermore, it's essential for the normal development of sebaceous glands and the production of meibum, preventing corneal dryness.

Gene References Into Functions
  1. miR-192-5p negatively regulates lipid synthesis via direct SCD1 regulation in a rat model of non-alcoholic fatty liver disease. PMID: 29290651
  2. SCD1 overexpression in fatty liver disease remains unaffected by fasting after prolonged fructose consumption in rats, highlighting its role in fructose-induced hepatic steatosis. PMID: 27697525
  3. Research explored the involvement of SCD1 activity in palmitate-induced pancreatic beta-cell autophagy. PMID: 26293158
  4. SCD1 activity and gene expression were significantly upregulated in Goto-Kakizaki rats, comparable to obese Zucker (fa/fa) rats. PMID: 23539346
  5. Adipose tissue SCD1 index increases in obesity-prone rats fed a high-fat diet. PMID: 23298201
  6. n-3 fatty acids repress constitutive triglyceride biosynthesis through SCD1 downregulation. PMID: 22047910
  7. SCD1 upregulation is crucial for oxidative muscle adaptation to endurance training. PMID: 20847127
  8. A method for quantifying SCD1 activity and its inhibition in primary rat hepatocytes is described. PMID: 20732836
  9. Exercise training regulates fat metabolism by downregulating hepatic SCD1 gene expression and protein content. PMID: 19777326
  10. SCD1 is involved in beta-cell protection from fatty acid toxicity by converting saturated to monounsaturated fatty acids for lipid incorporation. PMID: 19787047
  11. SCD1 gene overexpression is linked to hepatocarcinogenesis predisposition in mice and rats. PMID: 12419843
  12. SCD1 is degraded by a plasminogen-related protease. PMID: 12928439
  13. Leptin's role in regulating hepatic and adipose SCD1 mRNA expression is examined. PMID: 14592417
  14. Insulin-resistant skeletal muscle in ZDF rats shows increased SCD1 expression, possibly contributing to insulin resistance and type 2 diabetes. PMID: 16284748
  15. SCD1 protein gene expression is elevated in insulin-resistant rats fed a saturated fatty acid diet. PMID: 16357064
  16. SCD1 is necessary for the onset of diet-induced hepatic insulin resistance. PMID: 16741579
  17. SCD1 gene expression is elevated in skeletal muscle after semistarvation and remains elevated during refeeding. PMID: 16809433
  18. Vitamin A reduces weight gain in obese rats independently of SCD1 gene regulation. PMID: 18364238
  19. Stearoyl-CoA desaturase 1 transcript levels are higher in ovariectomized rats compared to controls. PMID: 18665039
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in liver (at protein level). Detected in adipose tissue. Detected in liver when rats are kept on a fat-free diet, but not when their food contains unsaturated fatty acids.

Q&A

What is the primary function of SCD1 in cellular metabolism?

SCD1 serves as a rate-limiting enzyme that catalyzes the conversion of saturated fatty acids (SFAs) to monounsaturated fatty acids (MUFAs), primarily oleate (18:1) and palmitoleate (16:1). These MUFAs represent major components of membrane phospholipids, triglycerides (TGs), and cholesterol esters (CEs) . The enzyme plays a critical role in maintaining the balance between saturated and unsaturated fatty acids in cellular lipid pools, which is essential for normal cellular function and membrane fluidity.

How is SCD1 expression regulated in different tissues?

SCD1 expression is highly regulated by metabolic conditions and varies significantly between tissues. In the heart, for example, exposure to glucose and insulin can induce SCD1 expression . Additionally, high-sucrose diets have been shown to increase SCD1 expression 3.6-fold in rat hearts without measurable changes in the expression of other lipogenic genes . Transcriptional regulation of SCD1 can be studied using luciferase reporter assays with cloned fragments of the SCD1 promoter .

What protein interactions are characteristic of SCD1?

While the search results focus primarily on yeast Ole1 (a homolog of mammalian SCD1), they reveal that these desaturases participate in important protein-protein interactions. In yeast, Ole1 interacts with multiple acyltransferases involved in lipid biosynthesis, including Sct1, Gpt2, Slc1, and Dga1 . These interactions suggest that SCD1 may function within multiprotein complexes coordinating lipid metabolism rather than acting in isolation. Similar interactions may exist for rat SCD1, though specific binding partners would need to be experimentally determined.

How does subcellular localization affect SCD1 function in different metabolic pathways?

The subcellular localization of SCD1 is critical for its functional role in specific metabolic pathways. Like other enzymes involved in lipid metabolism, SCD1's location can determine which pools of acyl-CoAs it can access and modify. The endoplasmic reticulum (ER) is a major site for SCD1 activity, positioning it to influence membrane lipid composition and lipid droplet formation .

When investigating SCD1 localization, researchers should be aware that subcellular fractionation methods often result in contamination between organelles. Confocal microscopy using specific antibodies to native proteins provides superior results for localization studies compared to overexpression systems with tagged proteins, which may not reflect endogenous distribution patterns .

What are the mechanistic links between SCD1 and endoplasmic reticulum stress in cardiac myocytes?

SCD1 plays a protective role against saturated fatty acid-induced stress in cardiac myocytes. Mechanistically, forced SCD1 expression attenuates excess fatty acid oxidation, restores reduced glucose oxidation, and substantially inhibits saturated fatty acid-induced caspase 3 activation . Furthermore, SCD1 prevents ceramide synthesis, diacylglycerol accumulation, and mitochondrial reactive oxygen species (ROS) generation that normally occur in response to saturated fatty acid overload .

These protective effects suggest that SCD1 induction serves as an adaptive response to alleviate adverse fatty acid catabolism in metabolically stressed cardiac tissue. The conversion of saturated to monounsaturated fatty acids appears to be a key mechanism by which SCD1 prevents lipotoxicity and cellular apoptosis .

How does SCD1 influence immune signaling pathways in cancer microenvironments?

SCD1 plays complex roles in tumor immunobiology. Inhibition of SCD1 in mouse tumor models enhances the production of CCL4 by cancer cells through reduction of Wnt/β-catenin signaling and by CD8+ effector T cells through reduction of endoplasmic reticulum stress . This leads to increased recruitment of dendritic cells (DCs) into tumors and enhanced induction and accumulation of antitumor CD8+ T cells .

Importantly, SCD1 inhibition or knockout synergizes with anti-PD-1 antibody treatment in mouse tumor models, suggesting that SCD1 modulation could potentiate immune checkpoint inhibitor therapy . High SCD1 expression has been observed in non-T cell-inflamed subtypes of human colon cancer, and serum SCD1-related fatty acids correlate with response rates and prognosis in patients with non-small cell lung cancer receiving anti-PD-1 therapy .

What are the optimal approaches for generating recombinant rat SCD1 for experimental studies?

Based on methodologies described in the research literature, recombinant SCD1 can be effectively generated using viral expression systems. The ViraPower adenoviral expression system has been successfully employed to create recombinant adenovirus for SCD1 overexpression (Ad-SCD1) .

For experimental protocols:

  • Clone the rat SCD1 coding sequence into an appropriate adenoviral vector

  • Generate viral particles in packaging cell lines

  • Amplify and purify adenovirus vectors using commercial purification kits

  • Titer the purified virus before experimental application

  • For control experiments, use LacZ recombinant adenovirus (Ad-LacZ) as a negative control

The purified recombinant adenovirus can then be used for in vitro studies with cell lines or in vivo delivery to animal models.

What are effective strategies for SCD1 knockdown in experimental systems?

For SCD1 knockdown studies, research has successfully employed RNA interference approaches. Specifically:

  • Design short hairpin RNA (shRNA) targeting conserved regions of rat SCD1 mRNA

  • Clone the shRNA sequences into adenoviral expression vectors (e.g., pBlock-it)

  • Example shRNA sequence for SCD1: 5′-CACCGAGTTTCTAAGGCTACTGTCTTCGAAAAGACAGTAGCCTTAGAAAC-3′

  • Use non-targeting shRNA (e.g., shLacZ: 5′-CTACACAAATCAGCGATTT-3′) as a negative control

  • Validate knockdown efficiency using quantitative RT-PCR and Western blot analysis

This approach allows for transient knockdown of SCD1 in various experimental systems to study loss-of-function effects.

How can researchers accurately measure SCD1 enzymatic activity in tissue samples?

While not explicitly detailed in the search results, established methods for measuring SCD1 activity include:

  • Fatty acid composition analysis: Measure the ratio of monounsaturated to saturated fatty acids (particularly 16:1/16:0 and 18:1/18:0 ratios) using gas chromatography-mass spectrometry (GC-MS) as an indirect indicator of SCD1 activity

  • Isotope labeling studies: Incubate samples with radiolabeled saturated fatty acid substrates (e.g., [14C]stearate) and measure conversion to monounsaturated products

  • Desaturation index calculation: Calculate the desaturation index (ratio of product to substrate) for palmitoleate/palmitate and oleate/stearate, which serves as a surrogate measure of SCD1 activity

  • Direct enzyme activity assay: Prepare microsomes from tissue samples and measure the conversion of [14C]stearoyl-CoA to [14C]oleoyl-CoA under appropriate conditions

For all activity measurements, appropriate controls (such as tissues from SCD1 knockout animals or samples treated with specific SCD1 inhibitors) should be included.

How does SCD1 function differ between metabolic syndrome models and normal physiology?

In metabolic syndrome models, SCD1 expression is significantly upregulated compared to normal physiological conditions. In rat hearts fed a high-sucrose diet (a model of metabolic syndrome), SCD1 expression increased 3.6-fold without measurable changes in other lipogenic genes . This suggests a specific regulatory mechanism targeting SCD1 in response to metabolic stress.

Functionally, induced SCD1 expression in metabolic syndrome serves a protective role by:

  • Attenuating excess fatty acid oxidation

  • Restoring reduced glucose oxidation

  • Inhibiting saturated fatty acid-induced apoptosis

  • Preventing ceramide and diacylglycerol accumulation

  • Reducing mitochondrial ROS generation

These protective effects may represent an adaptive response to alleviate saturated fatty acid-induced lipotoxicity in the context of metabolic syndrome.

What is the experimental evidence for SCD1's role in tumor microenvironment modulation?

SCD1 plays important roles in shaping the tumor microenvironment through multiple mechanisms:

  • Cancer cell signaling: SCD1 inhibition reduces Wnt/β-catenin signaling in cancer cells, leading to enhanced CCL4 production

  • T cell function: SCD1 inhibition in CD8+ effector T cells reduces endoplasmic reticulum stress, also enhancing CCL4 production

  • Dendritic cell recruitment: The increased CCL4 production promotes recruitment of dendritic cells into tumors

  • Antitumor immunity: SCD1 inhibition enhances induction and tumor accumulation of antitumor CD8+ T cells

  • Synergy with immunotherapy: SCD1 inhibition or knockout synergizes with anti-PD-1 antibody treatment in mouse tumor models

The clinical relevance of these findings is supported by observations that high SCD1 expression occurs in non-T cell-inflamed subtypes of human colon cancer, and serum SCD1-related fatty acids correlate with treatment outcomes in patients receiving immune checkpoint inhibitors .

How do protein-protein interactions influence SCD1 function in complex lipid biosynthesis pathways?

While direct evidence for rat SCD1 protein interactions is limited in the search results, insights from yeast Ole1 (a homolog of mammalian SCD1) suggest important principles. Ole1 interacts with multiple acyltransferases involved in lipid biosynthesis, including Sct1, Gpt2, Slc1, and Dga1 . These interactions indicate that desaturases participate in multiprotein complexes that coordinate lipid metabolism.

Key findings from the yeast system include:

  • These acyltransferases interact not only with Ole1 but also with each other, independent of Ole1

  • Specific protein domains and residues are critical for these interactions (e.g., the carboxyl-terminal region of Dga1)

  • Charged residues near the carboxyl terminus of interaction partners may be required for binding

For rat SCD1, it would be valuable to investigate whether similar interactions occur with mammalian acyltransferases and how these interactions influence the coordination of lipid synthesis pathways.

What are the major technical challenges in producing active recombinant rat SCD1?

While not explicitly detailed in the search results, producing active membrane-bound enzymes like SCD1 presents several technical challenges:

  • Membrane integration: SCD1 is an integral membrane protein with multiple transmembrane domains, making expression and purification challenging

  • Cofactor requirements: SCD1 requires specific cofactors (including iron, cytochrome b5, and NADH cytochrome b5 reductase) for activity

  • Stability issues: Membrane proteins often have stability issues when removed from their native lipid environment

Potential solutions include:

  • Using microsomal preparations rather than purified protein for activity studies

  • Incorporating the protein into nanodiscs or liposomes to maintain proper folding and activity

  • Expressing the protein in eukaryotic systems that properly incorporate cofactors and perform post-translational modifications

How can researchers distinguish between direct and indirect effects of SCD1 modulation in complex biological systems?

Distinguishing direct from indirect effects of SCD1 modulation requires carefully designed experimental approaches:

  • Complementary genetic and pharmacological approaches: Compare results from SCD1 inhibitors with genetic knockdown/knockout models. Agreement between these approaches strengthens evidence for direct effects

  • Rescue experiments: Determine if adding back specific SCD1 products (monounsaturated fatty acids) can reverse the effects of SCD1 inhibition

  • Temporal analyses: Examine the time course of changes following SCD1 modulation to identify primary (early) versus secondary (later) effects

  • Cell-type specific modulation: Use conditional knockout models or targeted delivery of inhibitors to determine if effects are cell-autonomous

  • Substrate specificity controls: Compare the effects of inhibiting SCD1 with inhibiting other enzymes in related pathways to identify specific versus general metabolic effects

The search results demonstrate this approach by using both pharmacological inhibitors and genetic manipulation (knockout) of SCD1 to validate its role in tumor immunity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.