Recombinant Rat Acyl-CoA desaturase 2 (Scd2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Scd2; Stearoyl-CoA desaturase 2; Acyl-CoA desaturase 2; Delta(9-desaturase 2; Delta-9 desaturase 2; Fatty acid desaturase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Scd2
Target Protein Sequence
MPAHILQEISGSYSATTTITAPPSGGQQNGGEKFEKNPHHWGADVRPEIKDDLYDPSYQD EEGPPPKLEYVWRNIVLMALLHIGALYGITLVPSCKVYTCLFAYLYYVISALGITAGAHR LWSHRTYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSH VGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGET FVNSLCVSTFLRYAVVLNATWLVNSAAHLYGYRPYDKNISSRENILVSMGAVGEGFHNYH HAFPYDYSASEYRWHINFTTFFIDCMALLGLAYDRKRVSKAAVLARIKRTGEESCKSG
Uniprot No.

Target Background

Function
Acyl-CoA desaturase 2 (SCD2) is an enzyme that introduces the first double bond into saturated fatty acyl-CoA substrates, utilizing O2 and electrons from reduced cytochrome b5. It catalyzes the insertion of a cis double bond at the delta-9 position in fatty acyl-CoA substrates, including palmitoyl-CoA and stearoyl-CoA, resulting in a mixture of 16:1 and 18:1 unsaturated fatty acids. SCD2 contributes to the biosynthesis of membrane phospholipids, cholesterol esters, and triglycerides, particularly during embryonic development and in neonates. It plays a crucial role in maintaining the normal permeability barrier function of the skin in neonates.
Gene References Into Functions
  1. Overt type 2 diabetes is associated with reduced islet expression of SCD2 and Elovl6. This can disrupt the desaturation of saturated fatty acids to monounsaturated fatty acids, making beta-cells more vulnerable to saturated fatty acid-induced ER stress and apoptosis. PMID: 21266672
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane.
Tissue Specificity
Detected in brain and adipose tissue, and at much lower levels in testis. Detected in liver when rats are kept on a fat-free diet, but not when their food contains unsaturated fatty acids.

Q&A

Expression Systems for Recombinant Rat Scd2

Q: What are the most effective expression systems for producing recombinant rat Scd2?

A: Bacterial expression systems, particularly Escherichia coli, have proven effective for expressing recombinant Scd proteins as demonstrated with rat ACS isoforms expressed as fusion proteins . For rat Scd2 specifically, a similar approach can be employed using Flag affinity tags at the C-terminus, which has been shown not to alter the kinetic properties of related enzymes . For mammalian expression, COS-7 cells have been successfully used for transient expression of human SCD isoforms and would likely work for rat Scd2 . Additionally, baculovirus-insect cell systems (Sf9 cells) offer another viable alternative for expressing membrane-bound proteins like Scd2, providing proper folding and post-translational modifications . The choice of expression system should be guided by the specific experimental objectives, such as whether native conformation or high yield is prioritized.

Purification Methods for Recombinant Rat Scd2

Q: What purification strategies yield the highest purity and activity for recombinant rat Scd2?

A: Affinity chromatography using epitope tags represents the most efficient purification strategy for recombinant rat Scd2. Flag affinity chromatography has been successfully employed for purifying rat ACS isoforms and can be adapted for Scd2 . The procedure typically involves expressing the protein as a fusion with a Flag epitope at the C-terminus, followed by affinity purification using anti-Flag antibody resin . When designing the purification protocol, it's crucial to consider that Scd proteins form oligomeric structures that may impact stability and activity . Buffer composition is critical—include appropriate detergents (such as Triton X-100) which have been shown to affect the activity of related enzymes . Preserving the oligomeric state during purification may be essential for maintaining enzyme stability and activity, as cross-linking studies have shown that oligomerization enhances Scd protein levels and activity .

Functional Assays for Scd2 Activity

Q: How can I reliably measure the enzymatic activity of purified recombinant rat Scd2?

A: Measuring rat Scd2 activity requires careful consideration of assay conditions and substrates. Based on studies with related enzymes, activity assays typically involve measuring the conversion of saturated fatty acyl-CoAs to their monounsaturated counterparts. The reaction requires ATP, CoA, and appropriate fatty acid substrates . When designing the assay, optimize pH conditions as different isoforms exhibit distinct pH optima . Consider including Triton X-100 in your reaction buffer, as some ACS isoforms show detergent dependence . The assay should be conducted at a temperature that maintains enzyme stability while providing sufficient activity; thermolability varies between related isoforms and should be determined empirically . For quantification, radiometric assays using labeled substrates provide high sensitivity, though HPLC-based methods offer good alternatives. When developing your assay protocol, establish appropriate controls including heat-inactivated enzyme preparations and substrate-omitted reactions to distinguish background from specific activity.

Comparative Analysis with Other Scd Isoforms

Q: How does rat Scd2 differ functionally and structurally from other Scd isoforms, and what methodologies best highlight these distinctions?

A: Comparative analysis between rat Scd2 and other isoforms requires a multi-faceted experimental approach. When examining kinetic parameters, determine and compare apparent Km values for substrates (e.g., ATP, fatty acids) and analyze maximum reaction velocities under standardized conditions, as has been done with ACS isoforms which showed distinct kinetic properties . For structural comparisons, assess thermolability profiles by measuring activity retention following pre-incubation at various temperatures; ACS isoforms demonstrated different thermolability characteristics that provide insights into structural stability differences . Examine pH dependence by conducting activity assays across a pH range (typically 6.0-9.0) to establish optimal pH values and profile shapes which can differ significantly between isoforms . Conduct inhibition studies using compounds like N-ethylmaleimide and phenylglyoxal which differentially affect related isoforms, potentially indicating distinctive active site architectures . For comprehensive isoform comparison, express multiple isoforms under identical conditions and subject them to parallel characterization to minimize experimental variation. This approach will reveal functional distinctions that might inform tissue-specific roles of different Scd isoforms.

Oligomerization and Its Impact on Enzyme Activity

Q: How does oligomerization affect rat Scd2 activity and stability, and what techniques can I use to study these oligomeric states?

A: Oligomerization appears to play a crucial role in regulating Scd enzyme stability and activity, as demonstrated with human SCD isoforms . To investigate oligomeric states of rat Scd2, employ SDS-PAGE analysis under various conditions, including different reducing agent concentrations, as human SCD proteins exhibited homodimers and higher-order oligomers when analyzed by SDS-PAGE . Use chemical cross-linking agents on intact cells expressing Scd2, as this approach has revealed dose-dependent increases in SCD protein levels and activity, suggesting oligomerization enhances stability . The ratio of dimers and oligomers to monomers remained relatively constant regardless of expression levels in human SCD studies, indicating that complex formation is an intrinsic property rather than concentration-dependent . For more detailed structural analysis, employ analytical ultracentrifugation or size-exclusion chromatography combined with multi-angle light scattering to characterize native oligomeric states. To establish a functional relationship between oligomerization and activity, consider using site-directed mutagenesis to disrupt potential dimerization interfaces based on sequence analysis, followed by activity measurements to correlate structural changes with functional outcomes.

Inhibition Studies and Structure-Function Relationships

Q: What approaches can be used to study inhibition patterns of rat Scd2 and what do they reveal about structure-function relationships?

A: Inhibition studies provide valuable insights into the structure-function relationships of rat Scd2. Examine the effects of established inhibitors like triacsin C, which showed differential inhibition of ACS isoforms (strongly inhibiting ACS1 and ACS4 but not ACS5) . Test thiazolidinedione compounds (troglitazone, rosiglitazone, and pioglitazone) which exhibited isoform-specific inhibition patterns for ACS enzymes . Determine IC50 values through dose-response experiments to quantify inhibitor potency, as demonstrated with troglitazone which showed an IC50 of less than 1.5 μM for ACS4 . Characterize the mechanism of inhibition (competitive, noncompetitive, uncompetitive, or mixed) by analyzing enzyme kinetics in the presence of varying inhibitor concentrations; troglitazone exhibited mixed-type inhibition of ACS4, providing insights into its interaction mode . Investigate structure-activity relationships by testing structural analogs—for instance, α-tocopherol (which shares structural features with troglitazone) did not inhibit ACS4, indicating the thiazolidine-2,4-dione moiety is critical for inhibition . Compare inhibition patterns across different Scd isoforms to identify selective inhibitors that can distinguish between closely related enzymes, potentially revealing unique structural features of rat Scd2.

Tissue-Specific Expression and Regulation

Q: How can I investigate tissue-specific expression patterns and regulatory mechanisms of rat Scd2?

A: Investigating tissue-specific expression patterns of rat Scd2 requires a combination of molecular and biochemical approaches. Perform Northern blot analysis using tissue-specific RNA samples and Scd2-specific probes, following protocols similar to those used for human SCD isoforms, which revealed differential expression patterns across tissues . Consider that different splice variants may exist, as observed with human SCD2 where adult and fetal tissues exhibited transcripts of different sizes due to alternative splicing in non-coding regions . Design PCR primers targeting conserved and variable regions of the rat Scd2 gene to detect potential tissue-specific splice variants, using techniques similar to those employed for human SCD genes . For quantitative analysis, implement real-time PCR using isoform-specific primers to compare expression levels across tissues and developmental stages. To investigate transcriptional regulation, analyze the promoter region of rat Scd2 for potential regulatory elements using bioinformatic approaches, followed by reporter gene assays to validate functional elements. Study post-transcriptional regulation through protein stability assays, as oligomerization has been shown to enhance stability of SCD proteins . This comprehensive approach will provide insights into the tissue-specific functions and regulatory mechanisms of rat Scd2.

Selection of Expression Systems

Q: What factors should I consider when selecting an expression system for rat Scd2 studies with specific research objectives?

Optimization of Purification Protocols

Q: What strategies can improve yield and preserve activity when purifying recombinant rat Scd2?

A: Optimizing purification protocols for recombinant rat Scd2 requires careful consideration of multiple factors to maximize yield while preserving enzymatic activity. Incorporate appropriate detergents throughout the purification process, as Scd2 is a membrane-bound protein; Triton X-100 has been shown to affect the activity of related enzymes and may be essential for solubilization and stability . Consider the oligomeric nature of SCD proteins when designing purification strategies—conditions that disrupt oligomerization may reduce stability and activity, as cross-linking studies have demonstrated that oligomerization enhances protein levels and enzymatic activity . When using affinity chromatography, optimize binding and elution conditions to maximize yield while minimizing non-specific interactions; affinity tags like Flag have been successfully used with related proteins . Implement protease inhibitors throughout the purification process to prevent degradation, and consider performing all steps at reduced temperatures (4°C) to preserve activity, particularly important given the variable thermolability observed in related isoforms . For proteins with specific pH requirements, maintain appropriate buffer pH throughout purification based on the established pH optima; different isoforms exhibit distinct pH optima that can significantly impact activity . Finally, assess protein quality at each purification step using activity assays rather than relying solely on protein concentration measurements to ensure that purification conditions preserve functional integrity.

Designing Valid Activity Assays

Q: How can I design robust activity assays for rat Scd2 that account for potential interfering factors?

A: Designing robust activity assays for rat Scd2 requires careful consideration of multiple factors to ensure specificity and reliability. Begin by determining the optimal reaction conditions through systematic evaluation of pH, temperature, and detergent requirements, as these parameters significantly affect enzyme activity and vary between isoforms . Include appropriate controls in every assay, such as heat-inactivated enzyme preparations to establish baseline measurements and account for non-enzymatic reactions. Consider potential interfering factors when designing the assay; for instance, endogenous desaturase activity in cell lysates may confound results when using crude preparations—purified enzyme preparations or specific inhibitors may help address this issue. When measuring activity in complex systems, employ isoform-specific inhibitors to distinguish between different desaturases; the differential inhibition patterns observed with compounds like triacsin C could be leveraged for this purpose . For kinetic studies, ensure substrate concentrations span an appropriate range (typically 0.2-5 times the Km value) to allow accurate determination of kinetic parameters. Validate the assay by demonstrating linearity with respect to enzyme concentration and reaction time under your experimental conditions. For detecting subtle changes in activity, optimize signal-to-noise ratio through appropriate substrate concentrations and sensitive detection methods. Finally, consider the potential impact of oligomerization on activity measurements, as oligomerization has been shown to enhance SCD activity .

Troubleshooting Common Experimental Issues

Q: What are the most common experimental challenges when working with recombinant rat Scd2, and how can they be addressed?

A: Researchers working with recombinant rat Scd2 commonly encounter several experimental challenges that can be systematically addressed. Low expression yields may result from protein toxicity to the host system; consider using inducible expression systems with optimized induction conditions or alternative host systems if toxicity is observed. Inclusion body formation in bacterial systems can be addressed by lowering expression temperature, co-expressing chaperones, or using fusion tags that enhance solubility. Poor enzyme activity despite successful expression may indicate improper folding or loss of essential cofactors; ensure appropriate detergent concentrations are maintained throughout purification, as detergent requirements have been shown to differ between related isoforms . Protein instability during purification might be addressed by optimizing buffer conditions, including protease inhibitors, and maintaining appropriate temperature throughout the process, particularly important given the variable thermolability observed in related enzymes . Inconsistent activity measurements could result from variability in oligomeric states; chemical cross-linking approaches might help stabilize oligomeric forms and yield more consistent results . For enzymes showing pH-dependent activity, ensure consistent pH throughout all experimental steps . When facing difficulties with specificity in activity assays, consider using isoform-specific inhibitors to distinguish between different desaturases; compounds like triacsin C and thiazolidinediones have shown differential inhibition patterns for related enzymes . Finally, address poor reproducibility by standardizing all aspects of the experimental protocol, including expression conditions, purification methods, and activity assay parameters.

Kinetic Parameter Determination

Q: What are the most appropriate methods for determining kinetic parameters of rat Scd2, and how should I interpret variations in these parameters?

A: Determining accurate kinetic parameters for rat Scd2 requires careful experimental design and data analysis. Establish initial reaction rates by measuring product formation over time, ensuring measurements are taken during the linear phase of the reaction to avoid substrate depletion effects. For Km determination, use substrate concentrations ranging from approximately 0.2 to 5 times the estimated Km value; insufficient range may lead to inaccurate parameter estimation. Apply appropriate curve-fitting methods—direct linear plots or non-linear regression analysis (preferably the latter) using software like GraphPad Prism or similar tools—to determine Km and Vmax values from substrate-velocity data. When interpreting variations in kinetic parameters, consider that differences in apparent Km values for substrates like ATP, as observed between ACS isoforms, may reflect distinct physiological roles or regulatory mechanisms . Variations in Vmax values may indicate differences in catalytic efficiency or substrate preference. Examine the effect of reaction conditions (pH, temperature, detergent concentration) on kinetic parameters, as these factors significantly affect enzyme behavior and have shown isoform-specific effects . For comprehensive characterization, determine kinetic parameters for multiple substrates to establish substrate specificity profiles. When comparing kinetic parameters between studies or conditions, ensure that experimental conditions are comparable, as differences in assay methods can significantly impact measured values.

Resolving Contradictory Results

Q: How should I approach contradictory results when characterizing rat Scd2 properties across different experimental systems?

Statistical Analysis of Activity Data

Q: What statistical approaches are most appropriate for analyzing rat Scd2 activity data, particularly for detecting subtle changes in enzyme behavior?

A: Appropriate statistical analysis of rat Scd2 activity data requires careful consideration of experimental design and data characteristics. For basic comparisons between experimental conditions, begin with descriptive statistics (mean, standard deviation, standard error) to summarize your data. Implement parametric tests (t-test for two conditions, ANOVA for multiple conditions) when data meet assumptions of normality and homogeneity of variance; perform normality tests (Shapiro-Wilk or Kolmogorov-Smirnov) to verify these assumptions. For non-normally distributed data, apply non-parametric alternatives such as Mann-Whitney U or Kruskal-Wallis tests. When detecting subtle changes in enzyme behavior, consider statistical power analysis during experimental design to determine the sample size needed to detect expected effect sizes; this is particularly important when studying small but physiologically relevant activity changes. For dose-response relationships or inhibition studies, apply regression analysis to determine IC50 values or other relevant parameters, as demonstrated in studies with ACS inhibitors . When analyzing complex datasets with multiple variables, consider multivariate statistical methods such as principal component analysis to identify patterns and relationships. For time-course experiments, implement repeated measures ANOVA or mixed-effects models to account for the non-independence of sequential measurements. Regardless of the statistical method chosen, report both statistical significance (p-values) and effect sizes to provide a complete picture of the biological relevance of observed differences.

Comparative Analysis with Published Literature

Q: How can I effectively compare my rat Scd2 research findings with published literature given methodological variations across studies?

A: Effective comparison of your rat Scd2 research findings with published literature requires a systematic approach that accounts for methodological variations. Create standardized comparison metrics that normalize for methodological differences; for example, when comparing enzyme activities, consider using relative activities (percentage of control) rather than absolute values to mitigate the impact of different assay conditions. Carefully document all methodological details in your study, including expression system, purification protocol, assay conditions, and data analysis methods, to facilitate accurate comparisons with other studies . When analyzing inhibition data, focus on comparing inhibition patterns and relative potencies rather than absolute IC50 values, which are highly dependent on experimental conditions; this approach was useful in studies of differential inhibition of ACS isoforms by triacsin C and thiazolidinediones . For kinetic parameters, consider the ratio of parameters (e.g., Km ratios for different substrates) which may be more consistent across studies than absolute values. Implement meta-analysis techniques when sufficient published data are available to systematically evaluate findings across multiple studies. When contradictions arise, examine methodological differences that might explain disparate results, such as differences in detergent requirements or pH optima observed between enzyme isoforms . Consider direct replication of key published experiments using their exact methodology alongside your preferred methods to directly assess the impact of methodological variations. Finally, maintain a critical perspective on both your own data and published findings, recognizing that methodological details often significantly impact experimental outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.