Recombinant Rat Adenosine monophosphate-protein transferase FICD (Ficd)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
Ficd; Protein adenylyltransferase FICD; AMPylator FICD; De-AMPylase FICD; FIC domain-containing protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Ficd
Target Protein Sequence
MILMPMASVVAVAEPKWVSVWGRFLWMTLLSMALGSLLALLLPLGAVEEQCLAVLRGFHL LRSKLDRAQHVVTKCTSPSTELSVTSRDAGLLTVKTKASPAGKLEAKAALNQALEMKRQG KRGKAHKLFLHALKMDPGFVDALNELGIFSEEDKDIIQADYLYTRALTISPFHEKALINR DRTLPLVEEIDQRYFSVLDSKVRKVMSIPKGSSALRRVMEETYYHHIYHTVAIEGNTLTL AEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINSTLVSRIGSVTIDHMLEIHRRVLGY VDPVEAGRFRRTQVLVGHHIPPHPRDVEKQMQEFTQWLNSEDAMNLHPVEFAALAHYKLV YIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSEYYHVLEVANEGDVRPFIRFIAK CTEVTLDTLLLATTEYSAALPEAQPNHSGFKETLPVRP
Uniprot No.

Target Background

Function
This protein acts as a dual-function enzyme, mediating both the addition (AMPylation) and removal (de-AMPylation) of adenosine 5'-monophosphate (AMP) to/from specific target protein residues, depending on the cellular context. The Glu-231 residue dictates whether the protein functions as an adenylyltransferase (AMPylation) or a phosphodiesterase (de-AMPylation). It plays a crucial regulatory role in the ERN1/IRE1-mediated unfolded protein response (UPR) by modulating the AMPylation/de-AMPylation status of HSPA5/BiP. Under normal conditions, it AMPylates HSPA5/BiP at Thr-518, leading to its inactivation. During endoplasmic reticulum stress, it removes the AMP moiety (de-AMPylation) from HSPA5/BiP at Thr-518, thereby restoring HSPA5/BiP activity. While capable of AMPylating Rho GTPases (RhoA, Rac, and Cdc42) in vitro, these are not considered physiological substrates.
Database Links

KEGG: rno:288741

UniGene: Rn.162153

Protein Families
Fic family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.

Q&A

What is the basic structural organization of rat FICD protein?

Rat FICD (Ficd) is a multi-domain protein with distinct functional regions. Its structure includes:

  • A transmembrane region that anchors the protein

  • Tetratricopeptide repeat (TPR) domains (TPR1 and TPR2) involved in protein-protein interactions

  • A linker region connecting the TPR domains to the catalytic domain

  • A Fic (filamentation induced by cAMP) domain that contains the catalytic core

  • An inhibitory region containing the regulatory glutamate residue (Glu234)

  • A catalytic core containing the essential histidine residue (His363)

These domains work in concert to regulate the enzyme's AMPylation and deAMPylation activities. The enzyme forms a dimer structure through a primary dimerization surface, which is crucial for its regulatory functions .

What is the primary biochemical function of FICD?

FICD catalyzes two opposing reactions in cellular protein regulation:

  • AMPylation: The covalent attachment of adenosine monophosphate (AMP) from ATP to target proteins. This typically occurs when FICD is in its monomeric form.

  • DeAMPylation: The removal of AMP from modified proteins, which predominates when FICD is in its dimeric configuration .

These opposing activities allow FICD to function as a molecular switch that regulates protein activity in response to cellular stress conditions. The enzyme uses ATP as a substrate for AMPylation, transferring the AMP moiety to hydroxyl groups (typically on serine, threonine, or tyrosine residues) of target proteins .

How does FICD relate to the unfolded protein response (UPR)?

FICD plays a central role in regulating the unfolded protein response through its interaction with BiP (a heat shock protein 70 family member). During endoplasmic reticulum stress:

  • FICD can AMPylate BiP, modifying its chaperone activity

  • Under stress conditions, calcium levels in the ER deplete and BiP AMPylation increases

  • AMPylated BiP helps refold misfolded proteins or can trigger apoptotic pathways when protein folding cannot be rescued

This mechanism represents a critical regulatory node for cellular adaptation to stress. Studies in Drosophila have shown that dFic (the Drosophila ortholog) regulates UPR in the endoplasmic reticulum by reversibly modifying BiP through AMP attachment .

What methods can be used to detect and quantify FICD-mediated AMPylation?

Several complementary techniques can effectively monitor FICD activity:

  • Fluorescence Polarization (FP) Assays: Using fluorescently labeled ATP (Fl-ATP) allows real-time monitoring of AMPylation activity. When Fl-ATP is unattached, it undergoes rapid rotation, depolarizing plane-polarized light with a low FP signal. Upon AMPylation, Fl-AMP becomes attached to the protein, reducing rotation and generating a higher FP signal .

  • In-gel AMPylation Assays: These can be performed using:

    • Fluorescently labeled ATP to visualize AMPylated proteins directly

    • Radioactive α-32P-ATP for highly sensitive detection of AMPylated proteins

  • NMR Spectroscopy: (31)P NMR has been used to monitor changes in phosphocreatine and ATP concentrations in studies examining AMPK activity in hypertrophied hearts .

  • Biochemical Assays: These can measure AMP/ATP ratios and quantify substrate phosphorylation to assess FICD activity indirectly .

For optimal results, researchers should combine multiple detection methods to validate findings and overcome limitations inherent to each technique.

What expression systems are recommended for producing active recombinant rat FICD?

For functional recombinant rat FICD production, consider the following expression approaches:

  • E. coli Expression System:

    • Advantages: High yield, cost-effective, rapid production

    • Considerations: May lack post-translational modifications; transmembrane domain may cause inclusion body formation

    • Recommendation: Express a truncated version (amino acids 104-458) lacking the transmembrane domain for improved solubility

  • Mammalian Expression Systems:

    • Advantages: Proper folding and post-translational modifications

    • Considerations: Lower yield, higher cost

    • Recommendation: Useful when studying FICD in its cellular context or when post-translational modifications are critical

  • Insect Cell Expression:

    • Advantages: Balance between yield and proper folding

    • Considerations: Intermediate complexity and cost

    • Recommendation: Good option for studies requiring the full-length protein with proper folding

The choice should be guided by the specific research questions. For structural and biochemical studies, bacterial expression of the truncated protein may be sufficient, while cellular studies may require mammalian expression systems.

How can researchers design experiments to distinguish between AMPylation and deAMPylation activities of FICD?

Distinguishing between these opposing activities requires careful experimental design:

  • Oligomeric State Control:

    • Monomeric FICD (FICDm) preferentially catalyzes AMPylation

    • Dimeric FICD (FICDd) preferentially catalyzes deAMPylation

  • Mutation-Based Approaches:

    • The L258D mutation promotes the monomeric state and AMPylation activity

    • Wild-type FICD typically exists in a dimeric state favoring deAMPylation

    • E234G mutation releases auto-inhibition and enhances AMPylation

  • Time-Course Experiments:

    • Set up assays with pre-AMPylated substrates

    • Monitor both formation and removal of AMP modifications over time

    • Use appropriate controls (catalytically inactive mutants) to distinguish enzymatic from non-enzymatic changes

  • Chemical Activators/Inhibitors:

    • Several compounds can shift the equilibrium between AMPylation and deAMPylation

    • Validate with in-gel assays using fluorescent or radioactive ATP

A systematic approach combining these strategies will provide robust data on the dual functionality of FICD.

What are the known physiological substrates of rat FICD?

Rat FICD has several identified substrates with important physiological roles:

SubstrateModification SiteFunctional ImpactDetection Method
BiP (Grp78)Ser/Thr residuesRegulates chaperone activity and protein folding during ER stressIn-gel assays, mass spectrometry
FICD itself (autoAMPylation)Multiple sitesSelf-regulation of enzymatic activityFluorescence and radioactive assays
Heat Shock ProteinsVarious residuesAffects protein aggregation dynamicsProtein interaction studies

BiP remains the most well-characterized substrate, with significant implications for the unfolded protein response pathway. In stressed cells, AMPylation of BiP affects its ability to bind misfolded proteins, thereby regulating the ER stress response .

How can novel FICD substrates be identified in rat tissue or cell samples?

Identification of novel FICD substrates requires multi-faceted approaches:

  • Substrate Trapping:

    • Use catalytically inactive FICD mutants (H363A) that can bind but not modify substrates

    • Co-immunoprecipitation followed by mass spectrometry to identify trapped proteins

  • Click Chemistry-Based Approaches:

    • Utilize ATP analogs with click-compatible moieties

    • Perform AMPylation reactions in cell lysates

    • Click-label modified proteins for enrichment and identification

  • Comparative Proteomics:

    • Compare proteomes of wild-type versus FICD knockout/overexpression models

    • Focus on proteins showing altered modification patterns

  • Candidate-Based Testing:

    • Focus on proteins involved in pathways where FICD is known to function (ER stress, protein folding)

    • Test candidates directly using in vitro AMPylation assays

  • Predictive Bioinformatics:

    • Analyze protein sequences for motifs similar to known FICD substrates

    • Prioritize proteins localized to the same cellular compartments as FICD

The most robust approach involves combining multiple methods to build confidence in newly identified substrates.

How does the oligomeric state of FICD regulate its enzymatic function?

The oligomeric state of FICD creates a sophisticated regulatory mechanism:

  • Monomeric vs. Dimeric Equilibrium:

    • Monomeric FICD (FICDm) predominantly functions as an AMPylator

    • Dimeric FICD (FICDd) primarily acts as a deAMPylator

  • Structural Basis of Regulation:

    • The inhibitory α-helix containing Glu234 sterically blocks ATP binding in the wild-type dimeric state

    • Dimerization creates an extensive hydrogen bond network between the dimerization area and active site

    • The β-flap region undergoes conformational changes that differ between monomeric and dimeric states

  • Allosteric Communication:

    • The dimerization interface communicates with the active site through an elaborate network of hydrogen bonds

    • Key residues (Glu242 and Lys256) form critical interactions that differ between AMPylation and deAMPylation states

    • These differences allow for precise control of catalytic activity based on oligomeric state

This dual functionality allows FICD to respond dynamically to cellular conditions, efficiently switching between adding and removing AMP modifications as needed.

What role does FICD play in neurodegenerative disease models?

FICD has emerging significance in neurodegenerative disease research:

  • α-Synuclein (α-syn) Regulation:

    • FICD can AMPylate misfolded α-synuclein, a protein associated with Parkinson's disease

    • AMPylation may influence α-syn aggregation properties and toxicity

    • Three potential pathways exist: BiP-mediated proper folding, FICD-mediated AMPylation, or pathological aggregation

  • C. elegans Models:

    • FIC-1 (C. elegans ortholog) affects protein aggregation dynamics

    • Studies show impacts on both neurodevelopment and neurodegeneration

    • FIC-1 influences Heat Shock Protein families critical for proteostasis

  • Stress Response Integration:

    • FICD links ER stress responses to protein aggregation mechanisms

    • AMPylation of chaperones like BiP affects their ability to manage misfolded proteins in neurodegenerative conditions

    • This represents a potential therapeutic target for modulating proteostasis in neurodegenerative diseases

Understanding these mechanisms could provide new therapeutic approaches for conditions like Parkinson's and Alzheimer's diseases.

How do AMPK signaling and FICD-mediated AMPylation pathways interact in cardiac tissue?

The relationship between AMPK signaling and FICD-mediated AMPylation in cardiac tissue involves complementary regulatory mechanisms:

  • Energy Sensing and Substrate Utilization:

    • In hypertrophied hearts (LVH), ATP concentration decreases by 10% and phosphocreatine decreases by 30%

    • This results in an AMP/ATP ratio increase of 5-fold above controls

    • These energetic changes correlate with increased AMPK activity (3.5-fold increase in α1 and 4.8-fold increase in α2)

  • Glucose Transport Regulation:

    • Basal 2-deoxyglucose uptake increases 3-fold in LVH

    • This increase is associated with higher levels of glucose transporters on the plasma membrane

    • AMPK signaling plays a crucial role in regulating this substrate utilization shift

  • Isoform-Specific Alterations:

    • AMPK α1 activity increase is accompanied by 2-fold higher expression

    • AMPK α2 expression decreases by 30% despite increased activity

    • These isoform-specific changes suggest complex regulatory mechanisms

While the search results don't explicitly connect FICD and AMPK, both systems respond to cellular energy status and stress conditions. Further research is needed to elucidate potential crosstalk between these important regulatory pathways in cardiac physiology and pathology.

What are common challenges in producing and purifying active recombinant rat FICD?

Researchers frequently encounter several challenges when working with recombinant rat FICD:

  • Solubility Issues:

    • The transmembrane domain (amino acids 1-23) often leads to poor solubility and aggregation

    • Solution: Express truncated versions (e.g., amino acids 104-458) lacking the transmembrane region

    • Alternative: Use mild detergents (0.1% DDM or 1% CHAPS) if full-length protein is required

  • Activity Preservation:

    • FICD can lose activity during purification due to conformational changes

    • Solution: Include stabilizing agents (5-10% glycerol, 1-5 mM DTT) in all buffers

    • Recommendation: Test activity immediately after purification and after storage to ensure stability

  • Oligomeric State Control:

    • Wild-type FICD exists in an equilibrium between monomeric and dimeric states

    • For consistent results, consider using mutations that lock the protein in specific states:

      • L258D for monomeric (AMPylation) studies

      • Wild-type for predominantly dimeric (deAMPylation) studies

  • Storage Conditions:

    • Store at -20°C for short-term or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles that can diminish activity

    • Consider storing working aliquots at 4°C for up to one week

Addressing these challenges systematically will improve experimental reproducibility and data quality.

What controls should be included in FICD enzymatic activity assays?

Robust experimental design requires several key controls:

  • Enzymatic Activity Controls:

    • Positive control: E234G mutant (constitutively active for AMPylation)

    • Negative control: H363A mutant (catalytically inactive)

    • Wild-type FICD with known activators or inhibitors

  • Substrate Controls:

    • Pre-AMPylated substrates (for deAMPylation assays)

    • Non-modifiable substrate mutants (e.g., T229A BiP mutant)

    • Heat-denatured substrates to confirm specificity

  • Reaction Component Controls:

    • No-ATP control to assess background

    • No-enzyme control to monitor non-enzymatic modifications

    • Magnesium dependency test (varying MgCl₂ concentrations)

  • Time Course Controls:

    • Multiple time points to ensure linearity of enzymatic reaction

    • Extended incubation to detect potential deAMPylation activity

  • Specificity Controls:

    • Cross-reactivity tests with related enzymes (e.g., IbpA-Fic2)

    • Competition assays with unlabeled ATP

Including these controls allows for confident interpretation of results and troubleshooting of unexpected outcomes.

What are emerging applications of FICD in studying cellular stress responses?

FICD research is expanding into several promising areas:

  • Integrated Stress Response Pathways:

    • FICD's role in linking ER stress to other cellular stress responses

    • Potential connections between UPR and mitochondrial stress responses

    • Cross-talk between AMPylation and other post-translational modifications in stress adaptation

  • Tissue-Specific Functions:

    • Differential roles of FICD in various rat tissues (brain, heart, liver)

    • Tissue-specific substrate preferences and activity regulation

    • Developmental changes in FICD expression and function

  • Therapeutic Applications:

    • FICD modulators as potential treatments for ER stress-related diseases

    • Targeting FICD to modify protein aggregation in neurodegenerative disorders

    • Development of AMPylation-specific probes for diagnostic applications

  • Comparative Biology Approaches:

    • Evolutionary conservation of FICD functions across species

    • Comparison between rat FICD and homologs in other organisms (human HYPE, Drosophila dFic, C. elegans FIC-1)

    • Identification of species-specific adaptations and substrates

These emerging directions highlight FICD's importance beyond conventional protein modification studies and suggest potential translational applications.

How might high-throughput screening approaches be designed to identify novel FICD modulators?

Designing effective high-throughput screens for FICD modulators requires specialized approaches:

  • Fluorescence Polarization-Based Primary Screens:

    • Utilize the FP assay with Fl-ATP to monitor AMPylation in real-time

    • Screen for compounds that either increase (activators) or decrease (inhibitors) FP signal

    • Optimize for 384-well or 1536-well format with appropriate controls

  • Bioluminescence Resonance Energy Transfer (BRET) Assays:

    • Design BRET pairs to monitor FICD oligomeric state changes

    • Screen for compounds that shift the monomer-dimer equilibrium

    • This approach can identify modulators of both AMPylation and deAMPylation

  • Cellular AMPylation Reporters:

    • Develop fluorescent or luminescent reporters responsive to BiP AMPylation

    • Screen for compounds that alter reporter signal in cellular contexts

    • Enables identification of compounds that work in physiological settings

  • Validation Cascade:

    • Primary hits validated with orthogonal assays (radioactive or fluorescent in-gel assays)

    • Counter-screens against related enzymes to ensure specificity

    • Dose-response curves to determine potency (EC50/IC50 values)

    • Cellular activity verification in relevant disease models

These approaches would enable identification of chemical tools to dissect FICD functions and potentially develop therapeutic compounds targeting AMPylation pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.