Recombinant Rat Adenosine receptor A2b (Adora2b)

Shipped with Ice Packs
In Stock

Description

Functional Roles of Adora2b

Adora2b is a low-affinity adenosine receptor activated under high extracellular adenosine levels, such as during hypoxia or inflammation . Key functions include:

Inflammation Regulation

  • Hypoxia Adaptation: Adora2b is transcriptionally induced by HIF1A during hypoxia, serving as a feedback loop to limit inflammation .

  • TNF-α Modulation: In ischemic kidney injury, Adora2b-deficient mice exhibit elevated TNF-α levels, worsening tissue damage .

  • Leukocyte Adhesion: Adora2b suppresses vascular adhesion molecules (e.g., VCAM-1) and leukocyte infiltration .

Metabolic and Vascular Effects

  • Insulin Resistance: Adora2b activation in diabetes increases proinflammatory cytokines (e.g., IL-6), exacerbating insulin resistance. Antagonism improves glucose uptake in muscle and adipose tissue .

  • Vascular Protection: Regulates endothelial barrier function and smooth muscle relaxation via cAMP signaling .

Applications in Research

Recombinant Adora2b is critical for:

Mechanistic Studies

  • Ligand Binding Assays: Used to screen adenosine receptor agonists/antagonists (e.g., ATL-802, a selective antagonist) .

  • Signal Transduction: Measures cAMP accumulation in response to adenosine analogs like NECA .

Disease Models

  • Acute Kidney Injury (AKI): Adora2b-null mice show exacerbated renal damage due to unregulated TNF-α .

  • Diabetes: Links to insulin resistance via IL-6 and CRP upregulation .

  • Pulmonary Inflammation: Highly expressed in type II alveolar epithelial cells, modulating lung injury responses .

Inflammatory Pathways

  • Adora2b deletion increases TNF-α and IL-6 in ischemic AKI, worsening outcomes .

  • Bone marrow transplants in Adora2b−/− mice restore anti-inflammatory signaling, highlighting hematopoietic cell-vasculature crosstalk .

Metabolic Dysregulation

  • Diabetic mice exhibit 4–6x higher Adora2b mRNA in macrophages and endothelial cells, correlating with IL-6 overproduction .

  • ADORA2B SNPs are associated with elevated CRP and IL-6 in humans, suggesting genetic links to diabetes severity .

Challenges and Considerations

  • Stability: Requires storage at -80°C with trehalose to prevent aggregation .

  • Species Specificity: Antibody cross-reactivity varies (e.g., ab229671 works in rat/mouse/human) .

  • Therapeutic Targeting: Prolonged Adora2b activation may worsen fibrosis or hypertension, necessitating precision in drug design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for precise delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize its development.
Synonyms
Adora2b; Adenosine receptor A2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL
Uniprot No.

Target Background

Function
Adenosine receptor A2b functions as a receptor for adenosine. Its activation is mediated by G proteins, which subsequently activate adenylyl cyclase.
Gene References Into Functions
  1. These findings suggest that activating the A2b receptor could offer a novel therapeutic approach to high glucose-induced cardiomyocyte injury. PMID: 29626279
  2. Increased A2BAR and adenosine levels following unilateral lung ischemia, along with a higher incidence of bronchiolitis obliterans organizing pneumonia in A2BAR mutant rats, point to a protective role for A2BAR signaling in mitigating ischemic lung injury. PMID: 28266889
  3. Renal fibroblasts express a functional AR1 receptor that inhibits cyclic AMP (cAMP) upon stimulation, leading to a functional AR2B receptor that increases cAMP upon stimulation. PMID: 27466291
  4. Our data indicate varying roles for A(2B)AR signaling in regulating blood pressure in SS rats. PMID: 26385692
  5. A2B receptors are downregulated during aging, leading to a reduced adenosine-mediated detrusor relaxation. PMID: 25728851
  6. The findings suggest that adenosine plays a role in signaling transmission via A2bR between taste cells in rats. PMID: 24327108
  7. Stimulation of A2B receptors provides protection against trauma and hemorrhagic shock-induced lung and muscle injury. PMID: 23584760
  8. Nitric oxide synthase/K+ channel cascade triggers the adenosine A(2B) receptor-sensitive renal vasodilation in female rats. PMID: 23396225
  9. The role of the A2B adenosine receptor (AR) in prostate cell death and growth was studied. PMID: 23315335
  10. Paracrine Ado A2b receptor signaling contributes to stimulus-evoked catecholamine secretion in hypoxic carotid body chemoreceptors. PMID: 23885058
  11. Hypoxia induced serotonin synthesis and secretion is amplified by ADORA2B signaling via MAPK/CREB and TPH-1 activation. PMID: 23638125
  12. We determined that the adenosine A(2B) receptor (A(2B)AR) mediates VEGF overproduction in ex vivo glomeruli exposed to high glucose concentration, requiring PKCalpha and Erk1/2 activation. PMID: 23069939
  13. 2',3'-cAMP inhibits proliferation of vascular smooth muscle cells from the aorta and coronary arteries. This effect is partially attributed to the metabolism of 2',3'-cAMP to adenosine, with engagement of the A2B receptor. PMID: 21622827
  14. The current study demonstrates that activation of A(2B)AR exhibits strong cardioprotective effects in the rat heart and suppresses transition pores in isolated cardiomyocytes. PMID: 21246204
  15. Endogenously produced luminal surface adenosine increases HCO3- secretion in an intact intestinal epithelium in vivo through the activation of A2B receptors. PMID: 20805305
  16. The A(2B)AR may contribute to the later stages of ischemic preconditioning, dependent on the induction of stress-responsive genes. PMID: 20797398
  17. A(2A) and A(2B) receptors are functionally expressed in juxtamedullary afferent arterioles. The powerful vasodilating action of adenosine predominantly involves A(2B) receptor activation, which counteracts A(1) receptor-mediated vasoconstriction. PMID: 20462966
  18. A(2B) receptors may play a crucial role in regulating vascular remodeling. PMID: 11882603
  19. 1,8-disubstituted xanthine derivatives: synthesis of potent A2B-selective adenosine receptor antagonists. PMID: 11906291
  20. Changes in expression of adenosine type-2B (A2B) receptors and a related intracellular second messenger were observed during chronic brain inflammation and following treatment with the NSAID drug flurbiprofen and its nitric oxide-donating derivative, HCT1026. PMID: 12807441
  21. The results indicate that adenylyl cyclase activation by adenosine and phosphorylation of CREB, but not ERK1/2 or p38, are primarily mediated via the adenosine A(2B) receptor. PMID: 12849998
  22. A2bR are critically involved in adenosine-mediated inhibition of cardiac fibroblast functions. PMID: 15284071
  23. The results suggest that adenosine A 2B- but not beta2-adrenoceptor-mediated facilitation of noradrenaline release is enhanced by ongoing activation of alpha2-adrenoceptors. PMID: 16040158
  24. A(2B) receptors may play a role in regulating glomerular remodeling associated with glomerular mesangial cell proliferation. PMID: 16103269
  25. The adenosine A(2B) receptor in the posterior hypothalamus plays an inhibitory role in central cardiovascular regulation, and guanylate cyclase mediates the depressor and bradycardiac actions of adenosine A(2B) receptors. PMID: 17363336
  26. These results suggest that purinergic inhibition of taurine efflux from pituicytes operates through A2b receptors coupled to intracellular cAMP increase. PMID: 17391106
  27. The proliferation-inhibiting A(2B)AR is itself an inducible receptor regulated by B-Myb. PMID: 17979185
  28. Activation of the adenosine A2b receptor results in protein kinase C-alpha-dependent removal of UNC5A from the cell surface. PMID: 17995930
  29. Furthermore, we demonstrated that A(2B)AR activation was necessary to promote higher expression of VEGF in kidney glomeruli upon exposure to high d-glucose concentration. PMID: 18060864
  30. A(2B) and D(2) receptors interact to modulate the release of catecholamine from the rat carotid body. PMID: 19536477

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of rat Adenosine A2b receptor?

Rat Adenosine A2b receptor (Adora2b) is a G protein-coupled receptor that primarily signals through activation of adenylyl cyclase. The receptor functions as a mediator for adenosine, with its activity primarily controlled by G proteins . Structurally, Adora2b shares high homology with other mammalian A2B receptor orthologs, with approximately 95% identity between rat and mouse A2B receptors at the amino acid level . The receptor is primarily localized in the cell membrane and contains important intracellular loops that participate in G protein coupling and signal transduction . The receptor demonstrates distinct pharmacological properties compared to other adenosine receptor subtypes and plays roles in various physiological processes including inflammation, metabolism, and cardiovascular function.

What are the key molecular characteristics of recombinant rat Adora2b?

Recombinant rat Adora2b has several distinct molecular characteristics that researchers should consider:

  • Molecular weight: The predicted band size of Adora2b protein is approximately 36 kDa

  • Subcellular localization: Primarily expressed in the cell membrane

  • G protein coupling: Predominantly couples to Gs proteins to activate adenylyl cyclase, but can also signal through Gi proteins under certain conditions

  • Alternative splicing: Unlike rabbit Adora2b, rat Adora2b does not appear to undergo alternative splicing at the junction identified in rabbit (corresponding to amino acids 103-111)

  • Pharmacological profile: Demonstrates distinct binding affinity profiles for various agonists and antagonists compared to human and other species orthologs

What cell lines are most suitable for studying recombinant rat Adora2b?

Several cell lines have been validated for studying recombinant rat Adora2b, each with specific advantages depending on the research questions:

  • HEK293 cells: Widely used for heterologous expression of Adora2b for pharmacological characterization, binding studies, and signaling pathway analysis . These cells provide a reliable expression system with minimal background adenosine receptor expression.

  • H9C2 rat cardiomyoblast cells: These cells endogenously express Adora2b and have been used to study receptor signaling in a more physiologically relevant context . H9C2 cells show comparable hypertrophic responses to primary rat cardiomyocytes, making them valuable for cardiovascular research.

  • Neuroblastoma cell lines (e.g., SK-N-SH, IMR32, SK-N-AS): These have been used for studying Adora2b expression and function in neuronal contexts .

When selecting an appropriate model system, researchers should consider their specific experimental goals, the desired expression levels, and whether the native cellular environment is important for their studies.

What are the optimal conditions for expressing recombinant rat Adora2b?

For optimal expression of recombinant rat Adora2b, consider the following methodological parameters:

  • Expression vector selection: Mammalian expression vectors with strong promoters (CMV or EF1α) typically yield good expression levels.

  • Transfection method:

    • For transient expression: Lipid-based transfection reagents typically yield 40-60% transfection efficiency in HEK293 cells

    • For stable expression: Selection with appropriate antibiotics (e.g., G418 or hygromycin) for 2-3 weeks following transfection

  • Expression verification: Western blot analysis using validated antibodies at 1:1000 dilution can confirm expression, with the expected band at approximately 36 kDa .

  • Membrane preparation: For binding studies, prepare membranes 48-72 hours post-transfection by homogenization in buffer containing protease inhibitors, followed by differential centrifugation to isolate the membrane fraction.

  • Storage conditions: Flash-freeze membrane preparations in liquid nitrogen and store at -80°C to maintain receptor integrity and binding properties.

Careful optimization of these parameters ensures reliable expression and functionality of the recombinant receptor for downstream applications.

What antibodies are recommended for detecting rat Adora2b in different applications?

Several antibodies have been validated for the detection of rat Adora2b in various applications:

AntibodyHostApplicationsDilutionsSpecies ReactivityNotes
ab229671RabbitWB, IHC-PWB: 1/1000, IHC-P: 1/500Human, Mouse, RatGenerated against synthetic peptide within human ADORA2B
bs-10205RRabbitWB, FCM, IHC-P, IHC-FWB: 1/300-5000, FCM: 1/20-100, IHC-P: 1/200-400, IHC-F: 1/100-500Human, Mouse, RatSourced from KLH-conjugated synthetic peptide derived from human ADORA2B

When selecting an antibody, consider:

  • The specific application (WB, IHC, FCM)

  • Sample type (tissue sections, cell lysates)

  • Cross-reactivity with other species if comparative studies are planned

  • Whether validation data exists specifically for rat samples

For optimal results, always validate antibodies in your specific experimental system using appropriate positive and negative controls.

What are the recommended radioligand binding assays for rat Adora2b?

Radioligand binding assays are crucial for characterizing the pharmacological properties of rat Adora2b. Several protocols have been established:

  • Saturation binding experiments:

    • Recommended radioligand: [³H]MRS 1754 has been validated for rat Adora2b with reliable results

    • Concentration range: Typically 0.1-20 nM for saturation studies

    • Non-specific binding definition: 200 μM NECA is commonly used

    • Incubation conditions: 25°C for 60 minutes in binding buffer (50 mM Tris-HCl, pH 7.4, 10 mM MgCl₂)

    • Data analysis: Fit to one-site binding model to determine Kd and Bmax values

  • Competition binding experiments:

    • Fixed radioligand concentration: Near the Kd value (typically 1-5 nM [³H]MRS 1754)

    • Competitor concentration range: 10⁻¹⁰ to 10⁻⁴ M depending on compound potency

    • Analysis: Calculate Ki values using the Cheng-Prusoff equation

These assays provide critical information on ligand affinity and receptor density, enabling comparative pharmacological studies across species and compounds.

How can I measure Adora2b-mediated signaling responses in cell-based assays?

Several functional assays can be employed to measure Adora2b-mediated signaling:

  • cAMP accumulation assays:

    • Since Adora2b primarily couples to Gs proteins that activate adenylyl cyclase, measuring cAMP production is a direct readout of receptor activation

    • Methodology: Treat cells with phosphodiesterase inhibitors (e.g., IBMX) followed by Adora2b agonists

    • Detection: Use ELISA-based kits or FRET-based biosensors for real-time measurements

    • Controls: Include forskolin as a positive control for cAMP production

  • ERK1/2 phosphorylation:

    • Adora2b activation can induce ERK1/2 phosphorylation through Gi-dependent mechanisms

    • This pathway can be blocked with pertussis toxin (PTX), confirming Gi involvement

    • Detection: Western blot using phospho-specific antibodies or in-cell ELISA methods

  • Calcium mobilization:

    • While primarily coupled to adenylyl cyclase, Adora2b can also induce calcium responses in some contexts

    • Use calcium-sensitive fluorescent dyes (Fluo-4 AM) in live-cell imaging platforms

  • Reporter gene assays:

    • Construct reporter plasmids containing cAMP-responsive elements (CRE) driving luciferase expression

    • Co-transfect with rat Adora2b expression vectors

    • Measure luciferase activity following stimulation with agonists

These functional assays provide complementary information about the complex signaling networks engaged by Adora2b activation.

What are the key pharmacological differences between rat Adora2b and human ADORA2B?

Despite high sequence homology, rat Adora2b exhibits distinct pharmacological properties compared to human ADORA2B:

  • Antagonist binding:

    • Xanthine derivatives often show 5-10 fold lower affinity for rat Adora2b compared to human ADORA2B

    • For example, certain 1,3,8-substituted xanthine derivatives display species-specific binding profiles

    • These differences are critical considerations in drug discovery programs and translational research

  • Agonist responses:

    • Traditional adenosine analogs like NECA activate both rat and human receptors but may show potency differences

    • Newer substituted 6-amino-3,5-dicyano-4-phenylpyridine derivatives have been developed with varying species selectivity

  • Signal transduction properties:

    • While both rat and human receptors primarily couple to Gs proteins, subtle differences in G protein coupling efficiency and secondary signaling pathways have been reported

    • Rat Adora2b may show differential sensitivity to PKC-mediated modulation compared to human ADORA2B

These pharmacological differences underscore the importance of species-appropriate experimental design and careful interpretation when translating findings between model systems.

How do protein kinases modulate rat Adora2b function?

Protein kinases, particularly Protein Kinase C (PKC), play critical roles in modulating rat Adora2b function:

  • PKC-mediated enhancement of signaling:

    • PKC activation by phorbol esters like PMA (phorbol 12-myristate 13-acetate) can enhance Adora2b-mediated cAMP accumulation

    • This enhancement occurs through multiple mechanisms, including:
      a) Direct phosphorylation of the receptor
      b) Modulation of G protein coupling efficiency
      c) Effects on adenylyl cyclase activity

  • Pathway-dependent modulation:

    • PKC can act either as an enhancer or inhibitor depending on the signaling pathway examined

    • In cAMP production pathways, PKC can mimic or enhance agonist effects

    • In some cell types, PKC may also negatively regulate receptor function through desensitization mechanisms

  • PKC isoform specificity:

    • PKCγ has been specifically implicated in both the functional enhancement and activation of Adora2b

    • Different PKC isoforms may have distinct regulatory effects on receptor function

  • Role of Gi proteins:

    • The modulatory effects of PKC on Adora2b signaling partially involve Gi proteins, as demonstrated by pertussis toxin sensitivity

    • This indicates cross-talk between different G protein pathways in Adora2b signaling

Understanding these regulatory mechanisms provides insights into the complex control of Adora2b signaling in physiological and pathological conditions.

How can I investigate the role of rat Adora2b in metabolic disorders?

Investigating rat Adora2b in metabolic disorders requires a multi-faceted approach:

  • High-fat diet (HFD) animal models:

    • Rats fed HFD for 12-14 weeks develop obesity and metabolic syndrome features

    • These models can be used to study Adora2b expression changes and potential therapeutic interventions

  • Pharmacological approaches:

    • Selective Adora2b antagonists like PSB-603 can be administered to investigate metabolic effects

    • Experimental design typically involves:
      a) HFD feeding for 12 weeks
      b) 2-week treatment with antagonist (intraperitoneal injection)
      c) Measurement of metabolic parameters

  • Key metabolic parameters to measure:

    • Body weight: Daily monitoring throughout treatment period

    • Lipid profile: Total cholesterol and triglycerides in blood

    • Glucose homeostasis: Glucose tolerance tests, insulin sensitivity assays

    • Inflammatory markers: TNF-α and IL-6 blood levels

  • Controls to include:

    • Non-selective adenosine receptor antagonists (e.g., theophylline) for comparison

    • Assessment of locomotor activity to rule out behavior-mediated effects on metabolism

Research using these approaches has revealed that selective Adora2b antagonism produces more favorable effects on lipid profiles compared to non-selective adenosine receptor inhibition, highlighting the specific role of this receptor subtype in metabolic regulation .

What experimental approaches can be used to study the cross-talk between Adora2b and other signaling pathways?

Investigating signaling cross-talk with Adora2b requires specialized experimental designs:

  • G protein signaling cross-talk:

    • Use of pertussis toxin to specifically inhibit Gi-mediated signaling while measuring Gs-dependent cAMP responses

    • This approach revealed that ERK1/2 activation by Adora2b is PTX-sensitive, indicating Gi involvement

    • Experimental protocol: Pretreat cells with PTX (100 ng/ml, 16-24 hours) before agonist stimulation

  • Protein kinase modulation:

    • PKC activators (PMA) in combination with Adora2b agonists (NECA) to study synergistic effects

    • PKC inhibitors (e.g., GF109203X, Gö6983) to block specific PKC isoforms

    • siRNA knockdown of specific PKC isoforms to determine isoform-specific effects

  • Receptor dimerization studies:

    • Co-immunoprecipitation techniques to detect physical interactions with other GPCRs

    • Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) assays

    • Functional complementation studies to assess the impact of heterodimer formation on signaling

  • Transcriptional regulation:

    • Chromatin immunoprecipitation (ChIP) assays to identify transcription factors activated downstream of Adora2b

    • Reporter gene assays with pathway-specific response elements

These approaches provide mechanistic insights into the complex signaling networks regulated by Adora2b and its integration with other cellular pathways.

How can I develop and validate Adora2b knockout or knockdown models in rat cells or tissues?

Development of Adora2b knockout or knockdown models requires careful validation and consideration of several methodological aspects:

  • CRISPR/Cas9-mediated knockout in cell lines:

    • Design guide RNAs targeting early exons of rat Adora2b gene

    • Recommended: Target at least 2-3 different sites to increase success probability

    • Validation strategies:
      a) Genomic DNA sequencing to confirm editing
      b) Western blot to verify protein loss using validated antibodies
      c) Functional assays to confirm loss of Adora2b-mediated responses

  • siRNA/shRNA knockdown approaches:

    • Design 3-4 different target sequences for optimal knockdown efficiency

    • Transfection optimization in rat cell lines (e.g., H9C2 cells)

    • Validation requirements:
      a) qRT-PCR to quantify mRNA reduction (typically >70% for robust phenotypes)
      b) Western blot to confirm protein reduction
      c) Functional rescue with exogenous expression to confirm specificity

  • In vivo knockout models:

    • CRISPR/Cas9 methods applied to rat embryos

    • Alternatively, consider zinc-finger nucleases or TALENs for rat genome editing

    • Comprehensive validation:
      a) Genotyping of founder animals and offspring
      b) Tissue-specific expression analysis
      c) Phenotypic characterization (metabolic, cardiovascular, inflammatory parameters)

  • Conditional knockout strategies:

    • Cre-loxP systems for tissue-specific or inducible knockouts

    • Tamoxifen-inducible systems for temporal control of gene deletion

These genetic models provide powerful tools for investigating the physiological roles of Adora2b in various contexts, complementing pharmacological approaches.

How can I address low expression levels of recombinant rat Adora2b?

Low expression of recombinant rat Adora2b can significantly impact experimental outcomes. Here are methodological solutions:

  • Vector optimization:

    • Use codon-optimized sequences for rat expression systems

    • Include a Kozak consensus sequence upstream of the start codon

    • Consider using vectors with stronger promoters (e.g., CAG promoter instead of CMV)

  • Expression enhancement strategies:

    • Include chaperone proteins (e.g., PDI, calnexin) to improve folding

    • Co-express with G proteins to stabilize the receptor

    • Use sodium butyrate (5-10 mM) treatment for 24-48 hours to enhance expression in mammalian cells

  • Protein stabilization approaches:

    • Include receptor ligands during expression to stabilize the conformation

    • Reduce culture temperature to 30-32°C to improve folding efficiency

    • Use proteasome inhibitors (e.g., MG132) at low concentrations to prevent degradation

  • Detection optimization:

    • For Western blot, use optimized lysis buffers containing specific detergents (DDM, CHAPS) suitable for membrane proteins

    • Include appropriate protease inhibitor cocktails to prevent degradation

    • Optimize antibody concentrations and incubation conditions for enhanced detection

These approaches can significantly improve the expression and detection of recombinant rat Adora2b in various experimental systems.

What are the common pitfalls in radioligand binding studies with rat Adora2b?

Radioligand binding studies with rat Adora2b present several technical challenges:

  • Non-specific binding issues:

    • Problem: High non-specific binding can mask specific binding signals

    • Solution: Use optimized buffer compositions (include 0.1% BSA to reduce non-specific binding)

    • Recommendation: Define non-specific binding with sufficiently high concentrations of competing ligands (e.g., 200 μM NECA)

  • Species-specific pharmacology considerations:

    • Challenge: Ligands optimized for human ADORA2B may show lower affinity for rat Adora2b

    • Solution: Adjust concentration ranges based on known species differences

    • Recommendation: Include well-characterized tool compounds as internal standards

  • Membrane preparation challenges:

    • Issue: Inconsistent receptor density in membrane preparations

    • Method: Standardize protein concentration (typically 10-50 μg/tube) and verify receptor expression

    • Approach: Perform saturation binding experiments to determine Bmax for each preparation

  • Data analysis complexities:

    • Challenge: Complex binding models may be necessary for certain ligands

    • Solution: Test multiple binding models (one-site, two-site, allosteric) and select based on statistical criteria

    • Recommendation: Calculate and report both Kd/Ki values and Bmax to facilitate cross-study comparisons

  • Equilibration time considerations:

    • Issue: Insufficient time to reach binding equilibrium

    • Approach: Perform time-course experiments to determine optimal incubation periods

    • Typical values: 60-90 minutes at 25°C for most Adora2b radioligands

Addressing these technical considerations ensures reliable and reproducible binding data for rat Adora2b.

How can I differentiate between direct and indirect effects on Adora2b signaling in complex cell systems?

Distinguishing direct from indirect effects on Adora2b signaling requires careful experimental design:

  • Pharmacological approaches:

    • Use subtype-selective antagonists:

      • MRS1754 for selective A2B blockade to confirm direct involvement

      • Include selective antagonists for other adenosine receptor subtypes as controls

    • Apply a range of antagonist concentrations to establish full concentration-response relationships

    • Example: In H9C2 cells, NECA-induced ERK1/2 activation was confirmed as A2B-mediated through selective antagonism

  • Genetic manipulation strategies:

    • siRNA-mediated knockdown of Adora2b (verify >70% reduction in expression)

    • Heterologous expression in null backgrounds

    • CRISPR/Cas9 knockout followed by rescue experiments with wild-type or mutant receptors

  • Signaling pathway deconvolution:

    • Use specific pathway inhibitors:

      • PTX for Gi-mediated pathways

      • PKC inhibitors for PKC-dependent effects

    • Apply time-course analyses to distinguish primary from secondary effects

    • Investigate pathway-specific readouts simultaneously (cAMP, ERK, calcium)

  • Control experiments to include:

    • Vehicle controls for all treatments

    • Concentration of adenosine deaminase to eliminate endogenous adenosine effects

    • Forskolin controls for direct adenylyl cyclase activation

    • Cell type-specific controls (comparing responses in cells with/without endogenous Adora2b)

These methodological approaches enable more rigorous attribution of observed effects to direct Adora2b activation versus indirect mechanisms mediated by other pathways.

What is the current evidence for targeting rat Adora2b in metabolic disease models?

Recent research has provided compelling evidence for targeting Adora2b in metabolic disease:

These findings highlight the potential of selective Adora2b antagonists as therapeutic candidates for metabolic disorders, particularly targeting dyslipidemia and obesity.

How do findings from rat Adora2b models translate to human clinical applications?

Translating findings from rat Adora2b models to human applications requires careful consideration of several factors:

  • Species differences in receptor pharmacology:

    • As documented in comparative studies, rat Adora2b shows different ligand binding profiles compared to human ADORA2B

    • Xanthine-based antagonists often show 5-10 fold lower affinity for rat Adora2b compared to human receptors

    • These differences must be accounted for when extrapolating dosing regimens to human studies

  • Translation considerations:

    • Successful translation requires adjusting dosages based on species-specific pharmacokinetics and pharmacodynamics

    • Allometric scaling should be applied for dose calculations between species

    • Target engagement biomarkers should be established to confirm on-target effects in humans

  • Physiological differences:

    • Despite conservation of the receptor, downstream signaling networks may vary between species

    • Metabolic pathways and inflammatory responses show species-specific characteristics

    • Different experimental readouts may be needed to assess efficacy across species

  • Clinical development pathway:

    • Preclinical data from rat models should be validated in human cells/tissues before clinical development

    • Humanized animal models expressing human ADORA2B may provide better translational insights

    • Careful patient stratification based on ADORA2B expression/function may enhance clinical success

These translational considerations are essential for developing effective ADORA2B-targeted therapies based on insights gained from rat models.

What are the key considerations for developing selective Adora2b-targeted compounds?

Developing selective Adora2b-targeted compounds requires addressing several critical challenges:

  • Structure-activity relationship considerations:

    • Xanthine derivatives serve as foundational scaffolds for Adora2b antagonists

    • Key modifications at positions 1, 3, and 8 of the xanthine core influence selectivity

    • Non-xanthine scaffolds, including 6-amino-3,5-dicyano-4-phenylpyridine derivatives, offer alternative starting points

  • Selectivity optimization strategies:

    • Screen compounds against all four adenosine receptor subtypes (A1, A2A, A2B, A3)

    • Target at least 100-fold selectivity for A2B over other subtypes

    • PSB-603 represents a benchmark selective antagonist with high potency and selectivity

  • Species considerations:

    • Test lead compounds against both rat and human Adora2b to identify species-conserved binding properties

    • Compounds with similar affinity across species facilitate better translational research

    • Account for documented 5-10 fold affinity differences between rat and human receptors for many compounds

  • Pharmacokinetic and drug-like properties:

    • Optimize for:

      • Blood-brain barrier penetration (if CNS effects are desired)

      • Oral bioavailability

      • Metabolic stability

      • Low toxicity profile

    • Balance potency with drug-like properties to ensure development potential

These considerations guide rational design of selective Adora2b modulators with therapeutic potential for metabolic and inflammatory disorders.

What are the emerging areas of rat Adora2b research beyond metabolic disorders?

Several promising research directions are emerging for rat Adora2b beyond metabolic applications:

  • Cardiovascular protection:

    • Both PKC activators and Adora2b activation protect rabbit heart, indicating cardioprotective potential

    • These effects can be blocked by the Adora2b antagonist MRS1754, confirming receptor involvement

    • Future research will likely explore the mechanisms and therapeutic potential in models of ischemia-reperfusion injury and heart failure

  • Neurological applications:

    • Expression of Adora2b in neural tissues suggests important CNS functions

    • Studies using neuroblastoma cell lines and brain tissue have demonstrated functional Adora2b expression

    • Emerging research areas include:

      • Neuroinflammatory conditions

      • Cerebral ischemia

      • Neurodegenerative disorders

  • Cancer biology:

    • Adora2b has been implicated in cancer progression and treatment

    • Research using cancer cell lines (e.g., U-87 MG glioblastoma) demonstrates functional Adora2b expression

    • Future directions may explore:

      • Tumor microenvironment modulation

      • Cancer cell proliferation and migration

      • Combination therapies with existing cancer treatments

  • Pulmonary and vascular disorders:

    • Emerging evidence suggests roles in:

      • Pulmonary hypertension

      • Vascular remodeling

      • Hypoxic adaptation

These expanding research areas highlight the diverse physiological roles of Adora2b and its potential as a therapeutic target across multiple disease states.

How can advanced genetic engineering approaches enhance rat Adora2b research?

Advanced genetic engineering approaches offer new opportunities for Adora2b research:

  • CRISPR/Cas9 genome editing applications:

    • Generation of knockin models with:

      • Fluorescent protein tags for live imaging

      • Epitope tags for improved detection and purification

      • Site-specific mutations to study structure-function relationships

    • Cell-type specific knockout models using tissue-specific promoters

    • Humanized rat models expressing human ADORA2B for improved translational research

  • Optogenetic and chemogenetic approaches:

    • Development of light-activated or designer drug-activated Adora2b variants

    • These tools enable precise temporal control of receptor activation

    • Applications include:

      • Dissecting signaling kinetics in real-time

      • Cell-type specific activation in complex tissues

      • Separating direct from network effects in vivo

  • Single-cell transcriptomics integration:

    • Combining genetic manipulation with single-cell RNA sequencing

    • This approach can reveal:

      • Cell-type specific responses to Adora2b modulation

      • Differential gene expression patterns in responder vs. non-responder cells

      • Novel downstream targets and pathways

  • In vivo biosensor development:

    • FRET/BRET-based sensors for monitoring:

      • cAMP dynamics in living animals

      • PKC activation patterns

      • Receptor conformational changes

    • These tools enable real-time monitoring of signaling events in physiological contexts

These advanced approaches will significantly enhance our understanding of Adora2b biology and facilitate the development of more targeted therapeutic strategies.

What unresolved questions remain in understanding the regulation of rat Adora2b expression and function?

Several critical questions remain unresolved in the field of rat Adora2b biology:

  • Transcriptional and epigenetic regulation:

    • What transcription factors and epigenetic modifications regulate tissue-specific Adora2b expression?

    • How is receptor expression altered in disease states?

    • What are the molecular mechanisms responsible for receptor upregulation in hypoxic and inflammatory conditions?

  • Post-translational modifications:

    • Besides PKC-mediated phosphorylation , what other post-translational modifications regulate Adora2b function?

    • How do these modifications affect:

      • Receptor trafficking

      • Ligand binding properties

      • G protein coupling selectivity

      • Receptor half-life and turnover

  • Signaling bias and ligand-specific effects:

    • Do different agonists induce distinct conformational changes leading to biased signaling?

    • How does the cellular context influence signaling output?

    • What determines the coupling preference between Gs and Gi pathways?

  • Receptor dimerization:

    • Does Adora2b form functional homo- or heterodimers with other GPCRs?

    • How does dimerization affect pharmacological properties and signaling?

    • What is the physiological relevance of potential dimerization in vivo?

  • Cross-species comparative biology:

    • Beyond pharmacological differences , what functional differences exist between rat and human Adora2b?

    • How can these differences inform more effective translational research?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.