Recombinant Rat Adenosine receptor A3 (Adora3)

Shipped with Ice Packs
In Stock

Description

Introduction to Adenosine Receptors

The adenosine receptor family consists of four distinct subtypes: A1, A2A, A2B, and A3. These receptors are activated by adenosine, an endogenous nucleoside that mediates numerous physiological and pathological functions including immunomodulation, energy balance, cardiac function, and neuroprotection . The A3 receptor was first cloned in 1991 and subsequently characterized as a distinct adenosine receptor subtype in 1993 .

Adenosine receptors are widely distributed throughout the body, with the A3 subtype expressed in various tissues including the brain, heart, lungs, liver, kidneys, and immune cells . This distribution pattern underlies their diverse physiological roles in regulating cardiac function, vasodilation, inflammation inhibition, ischemia-reperfusion injury protection, and oxidative stress suppression.

The rat adenosine A3 receptor has served as an important model system for understanding the fundamental properties of this receptor subtype, with recombinant expression systems enabling detailed characterization of its binding properties, signaling mechanisms, and pharmacological profile.

Recombinant Expression Systems for Rat Adora3

Recombinant expression systems have proven invaluable for studying rat adenosine A3 receptors under controlled experimental conditions. Chinese hamster ovary (CHO) cells represent one of the most widely utilized expression systems for rat A3 receptors, enabling stable expression for detailed pharmacological and functional characterization .

In functional studies, rat RBL-2H3 cell membranes have been employed to investigate A3 receptor-stimulated binding of [35S]GTPγS, providing critical insights into receptor activation mechanisms . These expression systems allow researchers to produce sufficient quantities of the receptor protein for comprehensive pharmacological and structural analyses.

The recombinant expression of adenosine receptors typically incorporates purification tags, such as the His tag, to facilitate protein isolation and characterization . While the specific expression and purification methods for rat Adora3 are not explicitly detailed in the available sources, these approaches typically involve mammalian cell expression systems to ensure proper protein folding and post-translational modifications essential for receptor functionality.

Pharmacological Properties of Recombinant Rat Adora3

The pharmacological profile of recombinant rat adenosine A3 receptors has been extensively characterized using various xanthine and adenosine derivatives. These studies have revealed fascinating insights into ligand-receptor interactions and species-specific pharmacological responses.

A particularly notable finding is that certain compounds can exhibit different efficacies at rat A3 receptors depending on the cellular context. For instance, 1,3-dibutylxanthine-7-riboside-5′-N-methylcarboxamide (DBXRM) demonstrates full efficacy in inhibiting adenylyl cyclase via rat A3 receptors in CHO cells, yet functions only as a partial agonist at the rat A3 receptor in RBL-2H3 cells . This observation highlights the complexity of receptor signaling and the influence of cellular environment on pharmacological responses.

Several xanthine-7-riboside derivatives exhibit enhanced affinity for rat A3 receptors compared to their parent xanthines. 1,3-dibutylxanthine-7-riboside (DBXR) acts as a partial agonist at the A3 subtype, while DBXRM functions as a full agonist . Additionally, 3′-deoxyDBXRM was synthesized and characterized as a partial agonist at rat A3 receptors while simultaneously functioning as an antagonist at rat A1 receptors . This dual activity within the same species represents a significant finding with potential therapeutic implications.

Table 1: Pharmacological Profile of Selected Compounds at Rat Adenosine A3 Receptors

CompoundChemical ClassActivity at Rat A3 ReceptorSelectivity ProfileBinding Affinity (Ki)
DBXRM (7b)Xanthine-7-ribosideFull agonist in CHO cells; Partial agonist in RBL-2H3 cells160-fold vs. A1; >400-fold vs. A2A230 nM
DBXR (7a)Xanthine-7-ribosidePartial agonistNot fully specifiedNot specified
3′-deoxyDBXRM (7c)Xanthine ribosidePartial agonist at A3; Antagonist at A1Dual activity profileNot specified
Cl-IB-MECAAdenosine derivativeFull agonist with high potency for desensitizationNot fully specifiedNot specified
I-AB-MECAAdenosine derivativeFull agonist with high potency for desensitizationNot fully specifiedNot specified

Signaling Mechanisms and Desensitization

Rat adenosine A3 receptors primarily couple to inhibitory G proteins (Gi), leading to inhibition of adenylyl cyclase and consequent reduction in intracellular cAMP levels . This signaling pathway has been extensively characterized through functional assays measuring A3 receptor-stimulated binding of [35S]GTPγS in rat RBL-2H3 cell membranes .

An important aspect of receptor function is desensitization, which involves attenuation of receptor responsiveness following prolonged or repeated agonist exposure. Studies have demonstrated that full agonists such as Cl-IB-MECA and I-AB-MECA exhibit greater potency and efficacy in causing desensitization of rat A3 receptors compared to partial agonists like DBXRM . This desensitization was quantified by measuring the loss of [35S]GTPγS binding, providing valuable insights into the relationship between agonist efficacy and receptor regulation.

These findings suggest that the efficacy classification of a ligand (full versus partial agonist) influences not only immediate signaling responses but also subsequent receptor regulation mechanisms, which has important implications for therapeutic development targeting these receptors.

Activation Mechanisms

Activation of adenosine A3 receptors involves classical conformational changes associated with GPCR activation. Structural comparisons between active, agonist-bound A3AR complexes and inactive, antagonist-bound structures reveal typical hallmarks of GPCR activation, including an outward movement of transmembrane helix 6 (TM6), inward movements of TM1 and TM7, and an upward shift of TM3 .

The activation mechanism involves propagation of conformational changes through conserved structural motifs, including the W6.48 "toggle switch," P5.50I3.40F6.44 motif, D3.49R3.50Y3.51 (DRY) motif, and N7.49P7.50xxY7.53 (NPxxY) motif . These coordinated structural rearrangements translate ligand binding into G-protein activation and downstream signaling.

While these structural insights derive primarily from human A3AR studies, they provide a framework for understanding the activation mechanisms of rat A3 receptors given the conservation of key structural elements across species.

Research Applications and Therapeutic Implications

Recombinant rat adenosine A3 receptors serve as valuable research tools for basic pharmacological characterization and drug discovery efforts. They enable detailed investigation of ligand-receptor interactions, signaling mechanisms, and receptor regulation processes.

The dual activity of certain compounds at different adenosine receptor subtypes, as exemplified by 3′-deoxyDBXRM acting as a partial agonist at rat A3 receptors while antagonizing rat A1 receptors , opens avenues for developing subtype-selective ligands with tailored pharmacological profiles.

The finding that human A3 receptors are primarily expressed in peripheral macrophages rather than sensory neurons suggests that the analgesic effects of A3 receptor agonists may involve more complex, indirect mechanisms, possibly through modulation of immune cell function . This highlights the importance of considering species differences when interpreting experimental findings and developing therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
Adora3; Adenosine receptor A3; TGPCR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR ACRLCQTSDSLDSNLEQTTE
Uniprot No.

Target Background

Function
Adenosine receptor A3 (Adora3) is a receptor for adenosine. Its activity is mediated by G proteins, which inhibits adenylyl cyclase. This receptor may play a role in reproduction.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Testis, particularly in spermatocytes and spermatids but not in spermatogonia. Low levels in the brain.

Q&A

What is the rat A3 adenosine receptor and how was it initially identified?

The rat A3 adenosine receptor belongs to the G-protein-coupled receptor (GPCR) superfamily. It was initially isolated from rat testis as an orphan receptor, having 40% sequence homology with canine A1 and A2A receptor subtypes. It was subsequently identified as homologous to the A3 receptor cloned from rat striatum . Unlike other adenosine receptor subtypes, the A3 receptor was cloned before its pharmacological characterization was complete, making it unique in the adenosine receptor family .

How does the rat A3 receptor differ structurally from other adenosine receptor subtypes?

The rat A3 receptor shares limited sequence similarity with other adenosine receptor subtypes. Within the adenosine receptor family (A1, A2A, A2B, and A3), there is 49% sequence similarity between A1 and A3 receptors, while A2A and A2B receptors have 59% sequence similarity . The rat A3 receptor preferentially couples to Gi/o proteins, similar to the A1 receptor, whereas A2A and A2B receptors typically interact with members of the Gs family of G proteins . These structural differences underlie the unique pharmacological profile and signaling properties of the A3 receptor.

What are the primary signaling pathways associated with rat A3 receptor activation?

The rat A3 receptor primarily signals through inhibition of adenylyl cyclase when expressed in Chinese hamster ovary (CHO) cells, leading to decreased cAMP production . Additionally, A3 receptor activation has been shown to stimulate phospholipase C (PLC) in rat RBL-2H3 mast cells and in brain slices . This dual signaling capability allows the receptor to influence multiple downstream pathways. While Gi/o proteins represent the primary coupling mechanism, evidence suggests A3 receptors may interact with other G protein types under specific conditions, further expanding their signaling repertoire .

What are the key differences between rat, mouse, and human A3 receptors?

Significant species differences exist among A3 receptors:

  • Sequence homology: Rat A3 receptor shares only 74% sequence homology with sheep and human A3 receptors, while there is 85% homology between sheep and human A3 receptors .

  • Pharmacological profiles: These sequence differences translate to markedly different pharmacological properties, particularly regarding antagonist binding . Most antagonists developed for human A3 receptors bind with much lower affinity to rat and mouse A3 receptors .

  • Amino acid identity: The amino acid sequence identity between human and rat A3 receptors is only 72%, with 73% sequence identity between human and mouse . These substantial differences impede translational research and necessitate careful consideration when extrapolating findings across species.

Why are most human A3 receptor antagonists ineffective in rat and mouse models?

Most synthetic antagonists developed for human A3 receptors are ineffective in rodents due to the significant species differences in receptor structure . For example:

  • Classical adenosine antagonists like caffeine and theophylline are weak antagonists at human adenosine receptors but entirely inactive at rat or mouse A3 receptors at concentrations up to 100 μM .

  • Potent human A3 antagonists such as MRS1220, MRE3008F20, PSB10, PSB-11, and VUF5574 show little to no activity at rat A3 receptors .

  • The binding affinities of certain ligands show dramatic species differences - for instance, N6-methyladenosine has binding affinities of 9.0 nM at human A3 receptors compared to 6.4 μM at rat A3 receptors, representing a >700-fold difference .

These species differences significantly complicate the validation of A3 receptor-related mechanisms in rodent models, creating a major challenge for translational research.

Which antagonists are validated for use with rat A3 receptors?

Very few antagonists are effective at both human and rodent A3 receptors. The literature identifies two main compounds suitable for rat A3 receptor studies:

  • DPTN: This antagonist shows good potency at rat A3 receptors with a Ki value of 8.53 nM. While it displays some selectivity for the A3 subtype, its Ki values at rat A1, A2A, and A2B receptors are 333 nM, 1147 nM, and 163 nM, respectively .

  • MRS1523: This compound has a Ki value of 216 nM at rat A3 receptors, making it moderately potent but less selective than at human A3 receptors (Ki = 43.9 nM) .

In contrast, MRS1191 and MRS1334 showed incomplete inhibition of radioligand binding to rat A3 receptors, limiting their utility . Researchers should be cautious when selecting antagonists and verify their pharmacological properties in the specific species being studied.

What agonists are effective for rat A3 receptor activation?

Several agonists have been characterized for rat A3 receptors:

  • Full agonists: Cl-IB-MECA and I-AB-MECA have been demonstrated to be full agonists at rat A3 receptors, showing high potency in functional assays measuring GTPγS binding .

  • Partial agonists: 1,3-Dibutylxanthine-7-riboside (DBXR) acts as a partial agonist at rat A3 receptors .

  • Full efficacy compounds: 1,3-Dibutylxanthine-7-riboside-5′-N-methylcarboxamide (DBXRM) acts with full efficacy at rat A3 receptors in inhibiting adenylyl cyclase .

  • Mixed pharmacology compounds: 3′-deoxyDBXRM (7c) was found to be a partial agonist at rat A3 receptors while simultaneously acting as an antagonist at rat A1 receptors, demonstrating that the same compound can have different activity profiles at different adenosine receptor subtypes within the same species .

What binding assays are recommended for characterizing ligand affinity at rat A3 receptors?

For radioligand binding studies with rat A3 receptors:

  • [125I]AB-MECA is the recommended radioligand for binding assays with rat A3 receptors. The method developed by Olah et al. (1994) using RBL-2H3 cell membranes (approximately 40 μg protein/tube) with 0.3 to 10 nM radioligand concentration (0.5 nM in competition binding assays) provides reliable measurements .

  • When performing competition binding studies, researchers should ensure that the concentration range of the competing ligand is sufficiently wide to fully characterize the binding curve, as some compounds show incomplete inhibition of radioligand binding to rat A3 receptors .

  • Expressing recombinant rat A3 receptors in Chinese hamster ovary (CHO) cells provides a clean system for binding studies, although native expression in RBL-2H3 cells may better represent physiological conditions .

What functional assays can assess rat A3 receptor activation and signaling?

Several functional assays are effective for measuring rat A3 receptor activity:

  • [35S]GTPγS binding assay: This assay measures the activation of G proteins coupled to A3 receptors in rat RBL-2H3 cell membranes, providing a direct measure of receptor activation . This approach is particularly useful for characterizing full and partial agonists.

  • Adenylyl cyclase inhibition assay: Since rat A3 receptors couple to Gi/o proteins, measuring the inhibition of adenylyl cyclase activity provides a functional readout of receptor activation . This assay has been used to demonstrate that compounds like DBXRM inhibit adenylyl cyclase via rat A3 receptors.

  • Cyclic AMP assays: These assays measure changes in intracellular cAMP levels as a functional readout of A3 receptor activation. Both agonist activity and antagonist blockade can be assessed using this approach .

  • Phospholipase C activation: Measuring phosphoinositide turnover in rat RBL-2H3 cells or brain slices can assess A3 receptor coupling to PLC pathways .

How does desensitization of rat A3 receptors occur and how can it be measured?

Rat A3 receptor desensitization is an important regulatory mechanism that affects signaling duration and intensity:

  • Mechanism: Full agonists such as Cl-IB-MECA or I-AB-MECA are more potent and effective than partial agonists like DBXRM in causing desensitization of rat A3 receptors . This desensitization is typically measured by loss of [35S]GTPγS binding capacity.

  • Experimental approach: To study desensitization, researchers can pretreat cells or membranes expressing rat A3 receptors with agonists of varying efficacy and then measure the subsequent response to a standard agonist challenge. The reduction in signaling capacity provides a quantitative measure of desensitization .

  • Correlation with efficacy: The degree of desensitization appears to correlate with agonist efficacy, suggesting that stronger activation leads to more pronounced receptor regulation. This relationship should be considered when designing experiments to study receptor signaling over extended periods .

What strategies can be employed to develop selective compounds for rat A3 receptors?

Developing selective ligands for rat A3 receptors presents unique challenges:

  • Structural modifications: Xanthine-7-ribosides have shown enhanced affinity compared to parent xanthines at rat A3 receptors. For example, 1,3-dibutylxanthine-7-riboside-5′-N-methylcarboxamide (DBXRM) has a Ki value of 230 nM at recombinant rat A3 receptors and is 160-fold and >400-fold selective versus rat A1 and A2A receptors, respectively .

  • Mixed pharmacology approach: Compounds can be designed to have differential activities at different adenosine receptor subtypes. For instance, 3′-deoxyDBXRM acts as a partial agonist at rat A3 receptors while functioning as an antagonist at A1 receptors . This mixed pharmacology may be advantageous for certain research applications.

  • Species-focused design: Given the significant species differences, compounds should be specifically designed and tested for rat A3 receptors rather than assuming human A3 receptor ligands will maintain similar properties . This necessitates parallel screening against both rat and human receptors during compound development.

What is the functional role of A3 receptors in cardiovascular protection in rat models?

A3 receptors play significant roles in cardiovascular protection through several mechanisms:

  • Preconditioning effects: Activation of A3 receptors has been shown to be involved in the cardioprotective effect of preconditioning by adenosine agonists . This protective mechanism helps prepare cardiac tissue to better withstand ischemic insults.

  • Hypotensive effects: A xanthine-insensitive component of the hypotensive effects of adenosine agonists in rats has been attributed to activation of mast cell A3 receptors . This indicates a role for these receptors in regulating vascular tone.

  • Therapeutic potential: Recent studies have shown that modulation of A3 receptor expression can ameliorate cardiovascular complications . Understanding the signaling pathways involved may lead to the development of novel therapeutic strategies for cardiovascular disorders.

  • Cardioprotection mechanisms: A3 receptor activation appears to trigger multiple cardioprotective pathways that might involve both direct effects on cardiomyocytes and indirect effects mediated through inflammatory cells .

How do rat A3 receptors contribute to inflammatory responses?

The rat A3 receptor plays multiple roles in inflammatory processes:

  • Mast cell function: A3 receptors are expressed in mast cells, including the rat RBL-2H3 mast cell line, where they can influence degranulation and mediator release .

  • Inflammatory mediators: Activation of A3 receptors has been implicated in the regulation of inflammatory responses, suggesting potential involvement in conditions like asthma where antagonists have been proposed as therapeutic agents .

  • Tissue distribution: The occurrence of A3 receptors in the lung suggests they may be important in regulating pulmonary functions, including inflammatory processes in respiratory tissues .

  • Anti-inflammatory potential: Recent research indicates that A3 receptor agonists may have anti-inflammatory properties, although the mechanisms may differ between species .

What genetic and molecular approaches can be used to study rat A3 receptor function?

Advanced molecular tools for studying rat A3 receptors include:

  • Receptor humanization: Due to the challenges of studying human A3 receptor antagonists in rat models, researchers have developed A3 receptor functionally humanized mice to evaluate human A3 receptor pharmacology in vivo . Similar approaches could be applied to rat models.

  • Mutagenesis studies: Site-directed mutagenesis of rat A3 receptors can identify critical amino acid residues involved in ligand binding and receptor function. This approach can help explain species differences and guide the design of more selective compounds .

  • RNA interference and gene editing: Techniques such as siRNA, shRNA, or CRISPR-Cas9 can be employed to modulate A3 receptor expression in rat cells or tissues, enabling studies of receptor function in various physiological processes.

How can computational approaches enhance rat A3 receptor research?

Computational methods offer powerful tools for advancing rat A3 receptor research:

  • Homology modeling: Creating computational models of the rat A3 receptor based on known GPCR structures can provide insights into binding pocket differences compared to human receptors .

  • Virtual screening: In silico screening of compound libraries against rat A3 receptor models can identify potential selective ligands for experimental validation .

  • Molecular dynamics simulations: These can reveal conformational changes associated with receptor activation and the impact of species-specific amino acid variations on ligand binding and receptor function .

  • Structure-activity relationship analyses: Comparing the effects of structural modifications across species can guide the rational design of compounds with desired selectivity and efficacy profiles for rat A3 receptors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.