Recombinant Rat ADP-ribosylation factor-like protein 6-interacting protein 6 (Arl6ip6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Arl6ip6; ADP-ribosylation factor-like protein 6-interacting protein 6; ARL-6-interacting protein 6; Aip-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSFVESWRSVGPRRRRQVTPGPVTRSVYSDYTQGNSWSEDGDEGCDQVARDLRAEFSARA SSESKRAPLLPRIGDGSPVLPDKRNGIFPATAAKRTQARRWPIQALSILCSLLFAVLLAF LLAIAYLIVKELHTENSKNEDVVDTGLLGFWSLLIISLTAGLSCCSFSWTVTYFDSFEPG MFPPTPLSPARFKKLTGHSFHMGYSMAILNGVVAALTVAWCLM
Uniprot No.

Target Background

Database Links
Protein Families
ARL6IP6 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of the Arl6ip6 gene in rats?

Rat Arl6ip6 (also known as Phosphonoformate Immuno-Associated Protein 1 or PFAAP1) is encoded by a gene located on chromosome 2. Similar to the human ortholog, the rat gene contains multiple exons that encode a protein involved in membrane trafficking and cytoskeletal organization. The recombinant partial form typically includes residues 1-223 of the full-length Rattus norvegicus Arl6ip6 (UniProt ID: Q68FV2), omitting regions unnecessary for target interactions or structural studies. The protein contains domains critical for interaction with ARF6 and other signaling proteins, allowing it to function in various cellular contexts.

How does rat Arl6ip6 differ from human ARL6IP6 in terms of function and structure?

While both rat Arl6ip6 and human ARL6IP6 share core functional domains, species-specific variations exist in sequence and regulatory mechanisms. Human ARL6IP6 spans from 152,717,893 to 152,761,253 on chromosome 2 (2q23.3) and contains 11 exons within its 43,361 bases . Functionally, both proteins interact with ARF6 GTPase and participate in membrane trafficking pathways, but studies suggest potential differences in tissue expression patterns and regulatory mechanisms. For instance, rat Arl6ip6 shows distinct response patterns to toxicological agents compared to the human ortholog, suggesting species-specific regulatory elements .

What is the subcellular localization pattern of Arl6ip6 and how does it relate to its function?

Arl6ip6 exhibits a dynamic subcellular distribution pattern associated with its function in membrane trafficking. Based on its interaction with ARF6, Arl6ip6 likely localizes to endosomal membranes and the plasma membrane, with its distribution shifting in response to cellular activation. In macrophages, ARF6 activation during phagocytosis is transient (peaking at 10 minutes), with Arl6ip6 facilitating membrane recruitment to phagocytic cups. Similar to the vesicular ARF6 redistribution observed in CHO cells upon bombesin treatment , Arl6ip6 may shuttle between intracellular vesicular compartments and the plasma membrane, coordinating membrane trafficking with cytoskeletal remodeling.

How should I design a valid experiment to study Arl6ip6 function in membrane trafficking?

A robust experimental design for studying Arl6ip6 in membrane trafficking requires careful consideration of variables, controls, and appropriate measurement techniques. Following experimental design principles , your approach should include:

  • Define your variables:

    • Independent variable: Arl6ip6 expression levels (wild-type, overexpression, knockdown)

    • Dependent variable: Membrane trafficking parameters (e.g., recycling rates, vesicle formation)

    • Control variables: Cell type, culture conditions, transfection efficiency

  • Include essential controls:

    • Negative control: Empty vector or non-targeting siRNA

    • Positive control: Known regulator of membrane trafficking

    • Expression control: Verification of Arl6ip6 levels

  • Measurement techniques:

    • Live-cell imaging with fluorescently tagged vesicular markers

    • Transferrin recycling assays

    • Surface biotinylation to measure protein internalization and recycling

  • Validate findings with complementary approaches:

    • Rescue experiments with wild-type Arl6ip6 in knockdown cells

    • Dominant-negative approaches targeting specific Arl6ip6 domains

What methodological approaches can I use to study the interaction between Arl6ip6 and ARF6?

To characterize the Arl6ip6-ARF6 interaction, several complementary methodologies should be considered:

  • Biochemical interaction studies:

    • Co-immunoprecipitation with specific antibodies against Arl6ip6

    • GST pull-down assays using recombinant proteins

    • Surface plasmon resonance (SPR), which has shown that recombinant Arl6ip6 binds ARF6-GTP with a dissociation constant (Kd) of 12 nM

  • Molecular manipulation approaches:

    • Express wild-type ARF6, constitutively active ARF6(Q67L), or dominant negative ARF6(T27N) mutants

    • Test physiological activators of ARF6, such as bombesin, which triggers redistribution of ARF6-containing endosomal vesicles to the cell surface

    • Use Gαq modulators, since bombesin-induced movement of ARF6 to the cell surface is regulated by Gαq

  • Visualization techniques:

    • Confocal microscopy with fluorescently tagged proteins

    • FRET or BRET analysis for real-time interaction studies

    • Super-resolution microscopy to identify specific membrane domains

  • Functional assays:

    • Phagocytosis assays in macrophages, where ARF6 activation peaks at 10 minutes with Arl6ip6 facilitating membrane recruitment

    • Cytoskeletal reorganization assessment following ARF6 activation

How can I resolve data inconsistencies in Arl6ip6 studies across different experimental systems?

Resolving data inconsistencies in Arl6ip6 research requires systematic analysis of variables that might contribute to divergent results:

  • Experimental model considerations:

    • Cell type-specific effects: Different cell lines may express varying levels of Arl6ip6 interactors

    • Species differences: Compare rat, mouse, and human ortholog functions directly

    • In vitro versus in vivo discrepancies: Validate cell culture findings in animal models

  • Technical approach standardization:

    • Antibody validation: Verify specificity of Arl6ip6 antibodies across applications

    • Expression system effects: Compare bacterial, insect, and mammalian expression systems for recombinant protein production

    • Detection method sensitivity: Optimize ELISA protocols for the 0.156-10 ng/ml detection range

  • Data integration strategies:

    • Meta-analysis of published findings

    • Systematic comparison using standardized protocols

    • Collaborative cross-validation between laboratories

  • Experimental design improvement:

    • Implement time-series experiments to capture dynamic responses

    • Use equivalent material designs to control for sample variability

    • Employ multiple time-series design to strengthen causal inferences

What signaling pathways does Arl6ip6 participate in, and how can we experimentally map these networks?

Arl6ip6 participates in multiple signaling networks, primarily centered around GTPase regulation and membrane dynamics. Based on functional enrichment analysis, Arl6ip6 is involved in:

  • GTPase signaling networks:

    • Signaling via RHOBTB3, Miro GTPases, and Rho GTPases

    • ARF6-mediated cytoskeletal rearrangements and membrane trafficking

    • Cross-talk with Rac1 signaling during peripheral cytoskeletal reorganization

  • Membrane trafficking pathways:

    • Regulation of protein-containing complex disassembly

    • Organelle localization

    • Regulation of intracellular transport

To experimentally map these networks, researchers can employ:

  • Proteomics approaches:

    • Affinity purification-mass spectrometry with Arl6ip6 as bait

    • Proximity labeling techniques (BioID, APEX) to identify neighboring proteins

    • Phosphoproteomics to identify downstream signaling events

  • Genetic screening methods:

    • CRISPR-Cas9 knockout screens for synthetic lethality

    • siRNA/shRNA screens for pathway components

    • Yeast two-hybrid screening for direct interactors

  • Pathway perturbation analysis:

    • Small molecule inhibitors targeting specific pathway components

    • Dominant negative constructs of suspected pathway members

    • Time-course analysis following stimulation with pathway activators

What is the role of Arl6ip6 in cytoskeletal dynamics and how does it coordinate with other regulatory proteins?

Arl6ip6 functions as a critical coordinator between membrane trafficking and cytoskeletal remodeling through its interaction with ARF6 and other regulatory proteins:

  • ARF6-dependent mechanisms:

    • ARF6 activation triggers cortical actin rearrangements, with Arl6ip6 potentially acting as a scaffold

    • Arl6ip6 participates in ARF6-mediated inhibition of stress fiber formation, potentially via downregulation of RhoA activation

    • In phagocytosis, Arl6ip6 facilitates membrane recruitment to phagocytic cups during the transient ARF6 activation phase

  • Cross-talk with other GTPases:

    • Coordination with Rac1-mediated cytoskeletal rearrangements, as ARF6 and Rac1 colocalize on endosomal vesicles

    • Regulation of RhoA-dependent stress fiber formation, with ARF6 (and potentially Arl6ip6) inhibiting RhoA activation

    • Involvement in signaling networks including RHOBTB3, Miro GTPases, and other Rho family members

  • Experimental approaches to study this coordination:

    • Live-cell imaging with fluorescently tagged actin and Arl6ip6

    • GTPase activity assays following Arl6ip6 manipulation

    • Quantification of different actin structures (stress fibers, cortical actin, protrusions) in response to Arl6ip6 modulation

How does Arl6ip6 expression respond to cellular stress, and what are the functional implications?

Arl6ip6 exhibits dynamic expression changes in response to various cellular stressors, suggesting a role in stress adaptation mechanisms. Gene-chemical interaction data reveals complex regulation patterns:

Chemical StressorEffect on Rat Arl6ip6Study MethodFunctional Implication
TCDDDecreases expression by 40%AhR signalingStress response modulation
Benzo[a]pyreneTissue-specific effects: upregulation in lung (1.5-fold), downregulation in kidney (2-fold)Expression analysisDifferential tissue adaptation
2,2',4,4'-Tetrabromodiphenyl etherDecreases expressionExperimental validationXenobiotic response
ArseniteInhibits G3BP1 binding to Arl6ip6 mRNAMultiple interactionsPost-transcriptional regulation
3H-1,2-dithiole-3-thioneDecreases expressionExperimental validationPotential chemopreventive mechanism
17β-estradiolDecreases expressionISO evidenceHormone response pathway

These expression changes suggest Arl6ip6 participates in:

  • Xenobiotic response pathways, potentially through aryl hydrocarbon receptor (AhR) signaling

  • Oxidative stress adaptation, as indicated by responses to arsenite

  • Hormone-responsive gene networks, based on estradiol effects

To study these relationships, researchers should:

  • Implement time-course experiments to capture dynamic responses

  • Combine transcriptomic and proteomic analyses to distinguish transcriptional and post-transcriptional effects

  • Assess functional consequences through stress resistance assays following Arl6ip6 manipulation

What are the critical factors in producing high-quality recombinant rat Arl6ip6 for structural and functional studies?

Production of high-quality recombinant rat Arl6ip6 requires careful consideration of expression systems, protein domains, and purification strategies:

  • Expression system selection:

    • Prokaryotic systems (E. coli): Suitable for domains without post-translational modifications

    • Eukaryotic systems (insect cells, mammalian cells): Better for preserving native conformation

    • Cell-free systems: Useful for difficult-to-express protein fragments

  • Construct design considerations:

    • The "partial" designation often indicates expression of residues 1-223 of full-length Rattus norvegicus Arl6ip6 (UniProt: Q68FV2)

    • Include appropriate affinity tags (His, GST, MBP) for purification

    • Consider solubility-enhancing fusion partners for hydrophobic regions

  • Purification strategy optimization:

    • Multi-step purification protocol including affinity chromatography, ion exchange, and size exclusion

    • Detergent selection for membrane-associated domains

    • Buffer optimization to maintain protein stability

  • Quality control metrics:

    • Purity assessment via SDS-PAGE and mass spectrometry

    • Functional validation through binding assays (e.g., SPR showing Kd of 12 nM for ARF6-GTP binding)

    • Structural integrity verification via circular dichroism or thermal shift assays

  • Storage considerations:

    • Lyophilization versus solution storage

    • Buffer composition to prevent aggregation

    • Aliquoting to avoid freeze-thaw cycles

How can I optimize ELISA protocols for accurate quantification of Arl6ip6 in complex biological samples?

Optimizing ELISA protocols for Arl6ip6 quantification requires addressing several technical aspects:

  • Sample preparation optimization:

    • For tissue homogenates: Standardize homogenization protocols and buffer composition

    • For cell lysates: Optimize lysis conditions to preserve Arl6ip6 epitopes

    • For biological fluids: Consider pre-clearing steps to reduce matrix effects

  • Assay parameters fine-tuning:

    • Working within the established detection range (0.156-10 ng/ml)

    • Diluting samples to mid-range concentrations for optimal accuracy

    • Determining appropriate incubation times and temperatures

  • Standardization and calibration:

    • Using recombinant Arl6ip6 standards matching the target species

    • Implementing standard curves with sufficient data points

    • Including internal controls across plates for multi-plate experiments

  • Validation approaches:

    • Spike-and-recovery experiments to assess matrix effects

    • Parallelism testing to confirm antibody recognition of native protein

    • Intra- and inter-assay variability assessment

  • Special considerations for rat Arl6ip6:

    • Be aware that kits are optimized for native samples rather than recombinant proteins

    • Different tertiary structures between native and recombinant proteins may affect detection

    • Stability concerns: The loss rate should be less than 5% within the expiration date under appropriate storage conditions

What are the optimal imaging techniques for visualizing Arl6ip6's dynamic behavior in living cells?

Visualizing Arl6ip6 dynamics in living cells requires advanced imaging approaches:

  • Fluorescent protein fusion strategies:

    • N- versus C-terminal tagging considerations based on protein topology

    • Selection of appropriate fluorophores (mEGFP, mCherry) based on spectral requirements

    • Validation of fusion protein functionality compared to untagged protein

  • Advanced microscopy techniques:

    • Spinning disk confocal microscopy for rapid dynamics with reduced phototoxicity

    • Total internal reflection fluorescence (TIRF) microscopy for plasma membrane events

    • Lattice light-sheet microscopy for extended 3D imaging with minimal photodamage

  • Specialized approaches for protein interactions:

    • Förster resonance energy transfer (FRET) for real-time interaction monitoring

    • Fluorescence recovery after photobleaching (FRAP) for mobility assessment

    • Fluorescence correlation spectroscopy (FCS) for concentration and diffusion analysis

  • Computational analysis methods:

    • Particle tracking for vesicle movement quantification

    • Colocalization analysis with appropriate statistical measures

    • Machine learning approaches for pattern recognition in complex dynamic data

  • Experimental design considerations:

    • Appropriate controls (untransfected, fluorophore-only)

    • Physiological temperature maintenance during imaging

    • Photostability evaluation and photobleaching correction

What is the evidence linking Arl6ip6 to disease pathogenesis, and how can we validate these associations?

Evidence linking Arl6ip6 to disease states comes from multiple sources:

To validate these associations, researchers should:

  • Implement comprehensive genetic screening:

    • Targeted sequencing in patient cohorts

    • Functional validation of identified variants

    • Development of animal models with equivalent mutations

  • Conduct detailed expression profiling:

    • Tissue microarray analysis across multiple disease states

    • Single-cell RNA sequencing to identify cell-type-specific effects

    • Correlation with clinical outcomes and disease progression

  • Perform mechanistic studies:

    • Knockdown/knockout in relevant cell lines and assessment of disease-related phenotypes

    • Rescue experiments with wild-type versus mutant proteins

    • Investigation of pathway alterations in disease contexts

How might Arl6ip6-targeted interventions be developed for therapeutic applications?

Development of Arl6ip6-targeted therapeutics requires a multifaceted approach:

  • Target validation strategies:

    • Genetic models (knockout, knockdown, overexpression) in disease-relevant systems

    • Pharmacological modulation of related pathway components

    • Analysis of disease-specific alterations in Arl6ip6 function

  • Potential therapeutic modalities:

    • Small molecule inhibitors targeting Arl6ip6-ARF6 interaction

    • Peptide-based disruptors of protein-protein interactions

    • Gene therapy approaches for loss-of-function contexts

    • Antisense oligonucleotides for expression modulation

  • Disease contexts for consideration:

    • Vascular disorders, based on connection to cutis marmorata telangiectatica congenita

    • Cancer applications, particularly hepatocellular carcinoma, drawing on findings with related protein ARL6

    • Inflammatory conditions, given interactions with immune cell functions

  • Preclinical development considerations:

    • Target engagement biomarkers

    • Pharmacodynamic readouts in cellular and animal models

    • Toxicity assessment, particularly for membrane trafficking mechanisms

    • Specificity evaluation against related family members

  • Translational challenges:

    • Tissue-specific delivery systems

    • Biomarker development for patient stratification

    • Resistance mechanisms and combination strategies

What cell-type specific functions of Arl6ip6 might contribute to its differential roles in disease states?

Arl6ip6 likely exhibits cell-type specific functions that influence its role in various disease contexts:

  • Immune cell functions:

    • In macrophages, Arl6ip6 facilitates ARF6-mediated membrane recruitment during phagocytosis

    • Potential involvement in immune cell trafficking and activation based on correlation with immune infiltration in HCC

    • Possible role in cytokine secretion pathways, similar to the function of cytokine IL-6

  • Epithelial cell activities:

    • Regulation of membrane protein recycling, potentially affecting receptor availability

    • Contribution to cell polarity maintenance through targeted membrane trafficking

    • Influence on epithelial-mesenchymal transition through cytoskeletal regulation

  • Neuronal processes:

    • Potential involvement in synaptic vesicle trafficking

    • Regulated membrane delivery during neuronal growth and plasticity

    • Cytoskeletal organization at growth cones and synapses

  • Experimental approaches for cell-type specificity:

    • Conditional knockout models with cell-type specific promoters

    • Single-cell analysis techniques to identify cell-specific expression patterns

    • Co-culture systems to assess cell-cell interaction effects

    • Tissue-specific proteomics to identify differential interactome components

What emerging technologies will advance our understanding of Arl6ip6 biology?

Several cutting-edge technologies show promise for advancing Arl6ip6 research:

  • CRISPR-based approaches:

    • Base editing for precise genetic manipulation

    • CRISPRi/CRISPRa for reversible expression modulation

    • CRISPR screening for systematic identification of genetic interactions

  • Advanced imaging techniques:

    • Super-resolution microscopy beyond the diffraction limit

    • Correlative light-electron microscopy (CLEM) for ultrastructural context

    • Expansion microscopy for enhanced spatial resolution of protein complexes

  • Proximity labeling methods:

    • TurboID, miniTurbo, or APEX2 fusions for rapid identification of protein neighborhoods

    • Spatially restricted enzymatic tagging for compartment-specific interactome mapping

    • Temporal control of labeling for dynamic interaction networks

  • Structural biology advances:

    • Cryo-electron microscopy for complex structural determination

    • Integrative structural biology combining multiple data types

    • Computational structure prediction with AlphaFold or RoseTTAFold

  • Spatial transcriptomics and proteomics:

    • Subcellular mapping of mRNA and protein localization

    • Tissue-level spatial analysis of expression patterns

    • Single-cell spatial proteomics for heterogeneity assessment

How can systems biology approaches be applied to understand Arl6ip6's role in integrated cellular networks?

Systems biology offers powerful frameworks for understanding Arl6ip6 in cellular context:

  • Network analysis approaches:

    • Integration of Arl6ip6 into protein-protein interaction networks

    • Pathway enrichment analysis, such as the finding that Arl6ip6 participates in pathways related to primary cilium development, ciliary landscape, extra-nuclear estrogen signaling, and regulation of protein-containing complex disassembly

    • Network perturbation analysis following Arl6ip6 manipulation

  • Multi-omics integration:

    • Correlation of transcriptomic, proteomic, and phosphoproteomic data

    • Metabolomic profiling to identify downstream functional effects

    • Lipidomic analysis to assess membrane composition changes

  • Mathematical modeling:

    • Kinetic models of Arl6ip6-ARF6 interaction dynamics

    • Agent-based modeling of membrane trafficking processes

    • Ordinary differential equation (ODE) models of signaling pathway integration

  • Data mining and artificial intelligence:

    • Machine learning for pattern recognition in complex datasets

    • Text mining of literature for hypothesis generation

    • Deep learning for prediction of functional relationships

  • Computational tools:

    • GeneMANIA for exploring genetic interactions, as done for Arl6ip6 showing connections to "ARL6IP6, ATL2, ARL6IP1, ARL6IP4, BBIP1, ARL6IP5, UNC50, CEP19"

    • Metascape for functional enrichment analysis

    • String and IntAct for protein interaction network visualization

What are the critical unanswered questions in Arl6ip6 research that limit our understanding of its function?

Several fundamental questions remain unanswered about Arl6ip6:

  • Structural biology questions:

    • What is the three-dimensional structure of Arl6ip6, and how does it change upon ARF6 binding?

    • Which domains are essential for specific protein-protein interactions?

    • How do post-translational modifications regulate Arl6ip6 function?

  • Regulatory mechanism uncertainties:

    • What are the transcriptional and post-transcriptional mechanisms controlling Arl6ip6 expression?

    • How is Arl6ip6 activity regulated in different cellular contexts?

    • What signaling events trigger Arl6ip6 redistribution within cells?

  • Functional role ambiguities:

    • What is the precise mechanism by which Arl6ip6 contributes to membrane trafficking?

    • Is Arl6ip6 function conserved across species, or do species-specific roles exist?

    • How does Arl6ip6 coordinate with other ARF6 interacting proteins?

  • Disease relevance questions:

    • What is the mechanistic link between Arl6ip6 dysfunction and vascular disorders?

    • Does Arl6ip6 play a direct role in cancer progression or immune regulation?

    • Are there unidentified diseases associated with Arl6ip6 mutations?

  • Experimental approach limitations:

    • How can we better distinguish the specific role of Arl6ip6 from related family members?

    • What in vivo models would best capture Arl6ip6 physiological functions?

    • How can we visualize endogenous Arl6ip6 dynamics without overexpression artifacts?

Addressing these questions will require integrated approaches combining cutting-edge technologies with rigorous experimental design and systems-level analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.