Recombinant Rat Alpha-1D adrenergic receptor (Adra1d)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology

  • Vascular Regulation: Knockout mouse studies demonstrate that Adra1d directly regulates arterial blood pressure via vasoconstriction. Adra1d−/− mice exhibit 30–40% reduced pressor responses to α1-agonists like phenylephrine and norepinephrine .

  • Cellular Localization: Unlike α1A and α1B subtypes, recombinant Adra1d requires heterodimerization with α1B-adrenergic receptors for proper cell surface expression and functional coupling in HEK293 cells .

  • Pathological Relevance: In rat bladder obstruction models, Adra1d mRNA expression increases from 25% to 75% of total α1-adrenergic receptor transcripts, suggesting compensatory upregulation .

Ligand Interactions:

  • Agonists: Non-selective endogenous ligands include (-)-adrenaline and (-)-noradrenaline .

  • Antagonists:

    • BMY 7378: Selective α1D antagonist (IC₅₀ = 1.4 nM) with partial agonist activity at α1A/α1B subtypes .

    • Cyclazosin: Shows slight selectivity for α1D in functional assays .

LigandSubtype SelectivityFunctional Role
BMY 7378α1D > α1A/α1BInhibits vasoconstriction in aortic tissue
TamsulosinNon-selective (α1A ≈ α1D)Used in bladder obstruction studies

Experimental Findings

  • Surface Expression: Confocal imaging reveals that recombinant Adra1d localizes intracellularly unless co-expressed with α1B receptors in HEK293 cells or DDT₁MF-2 smooth muscle cells .

  • Signal Transduction: Activation triggers Ca²⁺ mobilization via Gq/11 pathways, but coupling efficiency depends on co-receptor expression .

  • Therapeutic Insights: Mice lacking Adra1d show lower basal systolic blood pressure (≈10–15 mmHg reduction), highlighting its role in hypertension .

Research Applications

Recombinant Adra1d is critical for:

  1. Drug Discovery: Screening α1D-selective antagonists for cardiovascular diseases.

  2. Mechanistic Studies: Elucidating receptor dimerization and trafficking mechanisms .

  3. Disease Modeling: Investigating bladder dysfunction and hypertension using knockout models .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, kindly indicate them in your order remarks. We will prepare your order accordingly.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
Adra1d; Adra1a; Alpha-1D adrenergic receptor; Alpha-1A adrenergic receptor; Alpha-1D adrenoreceptor; Alpha-1D adrenoceptor; RA42
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-561
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MTFRDILSVTFEGPRSSSSTGGSGAGGGAGTVGPEGGAVGGVPGATGGGAVVGTGSGEDN QSSTGEPGAAASGEVNGSAAVGGLVVSAQGVGVGVFLAAFILTAVAGNLLVILSVACNRH LQTVTNYFIVNLAVADLLLSAAVLPFSATMEVLGFWAFGRTFCDVWAAVDVLCCTASILS LCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSVGPLLGWKEPVPPDERFC GITEEVGYAIFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGIKREPGKASEVVLRI HCRGAATSAKGYPGTQSSKGHTLRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFF VLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRR RLWAVYGHHWRASTGDARSDCAPSPRIAPPGAPLALTAHPGAGSADTPETQDSVSSSRKP ASALREWRLLGPLQRPTTQLRAKVSSLSHKIRSGARRAETACALRSEVEAVSLNVPQDGA EAVICQAYEPGDYSNLRETDI
Uniprot No.

Target Background

Function
This alpha-adrenergic receptor exerts its effect through the influx of extracellular calcium.
Gene References Into Functions
  1. These findings suggest that alpha-blockade reduces the urethral resistance associated with detrusor-sphincter dyssynergia, thereby enhancing voiding efficiency in SCI rats. PMID: 27605559
  2. NA promotes HSC-T6 cell activation, proliferation, and ECM secretion in vitro via the activation of Galpha-coupled alpha1B-AR and alpha1D-AR and the PKC-PI3K-AKT signaling pathway. PMID: 25283507
  3. Data suggest Adra1d expression is upregulated in diabetic kidney; PPAR (peroxisome proliferator-activated receptor) activation (via PPAR alpha or gamma agonists as hypoglycemic agents) suppresses renal expression of Adra1d in diabetic nephropathy. PMID: 24772448
  4. The alpha(1D)-adrenergic receptor is implicated in methamphetamine-induced hyperthermia and neurotoxicity. PMID: 23283760
  5. The effect of Ang II on a1B-AR mRNA seems to be influenced by the absence of a1D-AR in aortic smooth muscle cells. PMID: 21951585
  6. activation of alpha(1D)-AR releases ATP, which induces P2X(7) receptors to increase [Ca(2+)](i) but not to stimulate protein secretion in lacrimal glands PMID: 21685341
  7. pressor nerve responses in the pithed rat involve both alpha(1A) and alpha(1D)-adrenoceptor PMID: 21376031
  8. AT(1)R and alpha1D -adrenoceptor may form heterodimers, and may play a role in preeclampsia. PMID: 20102360
  9. physical and psychological stressors resulted in a rapid upregulation of alpha(1d) ADR mRNA in the dentate gyrus PMID: 20138850
  10. the expression, cellular localization and coupling to membrane signalling (inositol phosphate accumulation) of alpha(1)-adrenoceptor subtypes in a native tissue PMID: 20511116
  11. Inhibition of Adra1d leads to an increase in myoblast death in conditions that are generally associated with myoblast survival. PMID: 20110686
  12. cell surface expression of alpha1D-adrenergic receptors is controlled by heterodimerization with alpha1B-adrenergic receptors PMID: 14736874
  13. influence of adrenergic activity on bladder contractility increases with aging is due to overexpression of the AR1D PMID: 18581117

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1D sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Vas deferens, hippocampus, cerebral cortex, aorta, brain stem, heart and spleen.

Q&A

What is Alpha-1D adrenergic receptor and what are its functional roles?

Alpha-1D adrenergic receptor (α1D-AR or Adra1d) belongs to the G-protein-coupled receptor (GPCR) family and serves as a key mediator in the sympathetic nervous system. This receptor subtype plays critical roles in multiple physiological systems including cardiovascular regulation, urinary function, and central nervous system processes .

The receptor functions primarily as a mediator of vasoconstrictive and pressor responses to catecholamines, maintaining arterial blood pressure through smooth muscle contraction . Unlike other alpha-1 adrenergic receptor subtypes, the α1D-AR demonstrates particular importance in vascular function, as evidenced by knockout studies showing hypotension in mice lacking this receptor .

In the urinary system, α1D adrenergic receptors in urothelial cells regulate mechanosensitive bladder afferent nerve activity and reflex voiding through their influence on neurotransmitter release . The receptor also demonstrates significant expression in neural tissues, suggesting roles in neurological function that remain under active investigation .

How is Alpha-1D adrenergic receptor expression distributed across rat tissues?

Alpha-1D adrenergic receptor demonstrates distinct tissue distribution patterns that differentiate it from other alpha-1 adrenergic receptor subtypes. Expression analysis reveals:

TissueExpression LevelDetection MethodCitation
AortaHighRadioligand binding
HeartLow/ModerateImmunohistochemistry
Brain StemModerateWestern blot
NeocortexHigh (dendrites)Immunohistochemistry
UrotheliumModerateWestern blot, Immunohistochemistry
Peripheral Blood LymphocytesLowRT-PCR

Immunohistochemical analysis demonstrates that α1D-adrenoceptor is expressed in cardiomyocytes of the myocardium and in the smooth muscle of blood vessels . In the rat neocortex, the most intense staining appears in apical dendrites but is also present in the soma, with limited expression in cortical interneurons .

The receptor has been detected in intact living cells including Jurkat and PC12 cell lines through cell surface detection methods using specific antibodies against the extracellular domain . In radioligand binding studies, α1D-AR binding capacity was completely lost in the aorta of knockout mice while remaining unaltered in the heart, indicating tissue-specific expression patterns .

What experimental systems are available for studying Alpha-1D adrenergic receptor function?

Several experimental systems and methodologies have been developed for investigating Alpha-1D adrenergic receptor function in research settings:

  • Knockout Mouse Models: Gene targeting to create α1D-AR knockout mice (α1D-/-) provides valuable insights into physiological functions. These models allow assessment of cardiovascular parameters, including blood pressure regulation and response to catecholamines .

  • Reporter Assay Systems: Human Adrenoceptor Alpha 1D Reporter Assay Systems enable high-throughput screening of compounds that modulate receptor activity. These systems typically use 96-well format assays suitable for both agonist and antagonist studies .

  • RT-PCR and Expression Analysis: Reverse transcription-polymerase chain reaction techniques amplify receptor fragments (e.g., 540-bp α1D-adrenergic receptor fragment) to quantify expression levels across different tissues .

  • Radioligand Binding Assays: Using selective radioligands like [3H]prazosin combined with specific antibodies against receptor subtypes allows characterization of binding properties and receptor density in various tissues .

  • Functional Studies: Techniques such as cystometry, measurement of adenosine triphosphate concentrations, and afferent nerve recording can assess physiological responses to receptor activation or inhibition .

  • Immunohistochemistry: Specific antibodies targeting extracellular domains of the receptor enable visualization of tissue distribution patterns and subcellular localization .

How do Alpha-1D adrenergic receptor knockout models inform our understanding of cardiovascular regulation?

Alpha-1D adrenergic receptor knockout models have provided crucial insights into the specific cardiovascular functions of this receptor subtype. Studies utilizing α1D-/- mice reveal several key findings with significant implications for cardiovascular research:

The most striking phenotype in α1D-/- mice is hypotension under non-anesthetized basal conditions. These knockout mice maintain significantly lower systolic and mean arterial blood pressure relative to wild-type mice, demonstrating the receptor's fundamental role in maintaining vascular tone . Importantly, this hypotension occurs without significant changes in heart rate or cardiac function as assessed by echocardiogram, indicating a primarily vascular rather than cardiac mechanism .

Beyond basal hypotension, α1D-/- mice exhibit decreased pressor responses to alpha-adrenergic agonists. The pressor responses to phenylephrine and norepinephrine were reduced by 30-40% in knockout mice, confirming the receptor's role as a mediator of vasoconstrictive responses to catecholamines . This finding has significant implications for understanding the pharmacological action of alpha-adrenergic agents used clinically.

Radioligand binding studies in these models reveal that α1-AR binding capacity is completely lost in the aorta of knockout mice while remaining unaltered in the heart, demonstrating tissue-specific functions of different alpha-1 receptor subtypes . This suggests that α1D-AR is the predominant alpha-1 adrenergic receptor in major conductance vessels but may have less significance in cardiac tissue.

Research also indicates no apparent upregulation of other α1-AR subtypes in knockout mice, suggesting limited compensatory mechanisms and underscoring the unique physiological role of the α1D subtype in vascular function .

What protein interactions govern Alpha-1D adrenergic receptor localization and signaling?

The Alpha-1D adrenergic receptor engages in specific protein-protein interactions that critically influence its cellular localization, signaling properties, and pharmacological responses. Advanced proteomic investigations reveal a complex interaction network with significant functional implications:

The α1D-adrenergic receptor binds to the syntrophin family of PDZ domain proteins (SNTA, SNTB1, and SNTB2) through a C-terminal PDZ ligand interaction . This interaction is highly specific, as proteomic analysis of 23 human GPCRs containing Type I PDZ ligands revealed that syntrophins did not interact with any other GPCRs . Syntrophin binding ensures appropriate plasma membrane localization of the receptor and facilitates efficient G-protein coupling, suggesting a crucial role in receptor trafficking and signaling efficiency .

Unexpectedly, a second PDZ domain protein, scribble (SCRIB), has been detected in ADRA1D complexes . Biochemical, proteomic, and dynamic mass redistribution analyses indicate that syntrophins and SCRIB compete for the PDZ ligand binding site but can simultaneously exist within an ADRA1D multimer . This suggests a more complex receptor architecture than previously understood.

Perhaps most significantly, these different protein interactions impart divergent pharmacological properties to the complex . The modular dimeric architecture of ADRA1D in cell membranes provides unexpected opportunities for fine-tuning receptor function through novel protein interactions in vivo . This finding has significant implications for drug discovery, suggesting possibilities for developing compounds that could stabilize or disrupt specific GPCR:PDZ protein interfaces for therapeutic benefit .

What role does Alpha-1D adrenergic receptor play in urological function?

The Alpha-1D adrenergic receptor serves critical functions in urological physiology, particularly in bladder function and micturition control. Studies employing pharmacological and genetic approaches have elucidated several key mechanisms:

Alpha-1D adrenergic receptors are expressed in the urothelium of the rat bladder, as confirmed by both Western blot analysis and immunohistochemistry . This expression pattern provides a molecular basis for understanding sympathetic regulation of bladder function through direct actions on urothelial cells.

Experimental evidence shows that activation of these receptors in urothelial cells triggers the release of neurotransmitters, including adenosine triphosphate (ATP) . In functional studies, the selective α1D receptor antagonist naftopidil significantly decreased ATP levels in the bladder perfusate during bladder distention by 36.6% . This indicates that endogenous catecholamines act on α1D receptors in the urothelium to modulate ATP release, which serves as a key signaling molecule in bladder mechanosensation.

The physiological significance of this pathway is demonstrated by experiments showing that α1D receptor inhibition affects reflex voiding. Administration of naftopidil prolonged the intercontraction interval during continuous infusion cystometrograms in conscious rats (143% of the control value) . Moreover, it suppressed the excitatory effect of intravesical infusion of acetic acid (0.1%) on the intercontraction interval (220%) .

Mechanistically, α1D receptor antagonism inhibits bladder afferent nerve activity induced by bladder distention (32.0% reduction) and acetic acid infusion (30.4% reduction) . These findings establish that α1D adrenergic receptors in the urothelium facilitate mechanosensitive bladder afferent nerve activity and reflex voiding through modulation of sensory pathways .

What methodological approaches are most effective for studying Alpha-1D adrenergic receptor pharmacology?

Studying Alpha-1D adrenergic receptor pharmacology requires specialized methodological approaches that address the unique properties of this receptor subtype. The following methodological strategies have proven particularly effective:

Reporter Assay Systems: Human Adrenoceptor Alpha 1D Reporter Assay Systems provide a controlled environment for evaluating compound effects on receptor activity . These assays can be configured in both agonist and antagonist modes, allowing comprehensive pharmacological characterization. Key considerations include:

  • Appropriate positive controls with known pharmacological properties

  • Careful preparation of test compounds with attention to solubility and stability

  • Consideration of automated dispensing for higher throughput screening

Binding Affinity Studies: Radioligand binding assays using [3H]prazosin as a radioligand have demonstrated high-affinity binding to α1D receptors with a dissociation constant value of 0.65±0.05 nmol/L and a maximum density of binding sites of 175.3±20.5 fmol/106 cells in human peripheral blood lymphocytes . For subtype selectivity determination, competitive binding studies using subtype-selective antagonists or antibodies against specific receptor subtypes are essential.

Functional Assessments: For physiological evaluation, multiple complementary approaches should be employed:

  • Cardiovascular Assessment: Blood pressure monitoring in conscious animals provides the most physiologically relevant data, as α1D-/- mice show significant differences in basal blood pressure and responses to adrenergic agonists .

  • Urological Function: Cystometrography combined with measurement of adenosine triphosphate concentrations and afferent nerve recording offers comprehensive evaluation of urological effects .

  • Molecular Interactions: Proteomic analyses including tandem affinity purification/mass spectrometry (TAP/MS) and dynamic mass redistribution studies can identify and characterize protein-protein interactions that modulate receptor function .

An integrated approach combining these methodologies provides the most complete picture of Alpha-1D adrenergic receptor pharmacology, enabling the identification of subtype-selective compounds and elucidation of complex signaling mechanisms.

How can researchers distinguish Alpha-1D adrenergic receptor effects from other alpha-1 receptor subtypes?

Distinguishing Alpha-1D adrenergic receptor effects from other alpha-1 receptor subtypes requires careful experimental design and specialized techniques:

Receptor Expression Profiling: Before conducting functional studies, researchers should characterize the expression profile of alpha-1 receptor subtypes in their experimental system using RT-PCR or protein detection methods. In peripheral blood lymphocytes, for example, RT-PCR amplifies distinct fragments for each subtype: a 348-bp α1A-adrenergic receptor fragment, a 689-bp α1B-adrenergic receptor fragment, and a 540-bp α1D-adrenergic receptor fragment . These profiles can guide interpretation of functional data.

Subtype-Selective Pharmacological Tools: The following pharmacological approaches enhance subtype discrimination:

ApproachMethodologyAdvantagesLimitations
Selective AntagonistsUse of compounds with known selectivity profilesNon-invasive, applicable to in vivo studiesFew highly selective compounds available
Antibody-Based InhibitionAntibodies against α1A-, α1B-, and α1D-subtypesHigh specificity for target receptorsLimited to in vitro applications, potential off-target effects
Genetic Knockdown/KnockoutsiRNA, knockout modelsDefinitive subtype eliminationCompensatory upregulation of other subtypes

Tissue Selection Strategy: Leveraging tissues with predominant expression of specific subtypes provides a natural system for studying subtype-specific effects. For example, radioligand binding studies show that α1-AR binding capacity in the aorta was lost in α1D-/- mice, while binding in the heart was unaltered, suggesting the aorta as an appropriate tissue for studying α1D-specific effects .

Functional Readouts with Subtype Specificity: Certain physiological responses show greater dependence on specific subtypes:

  • Vascular smooth muscle contraction in major conductance vessels is predominantly mediated by α1D-AR

  • Bladder afferent nerve activity shows significant α1D-AR dependence

By combining these approaches, researchers can achieve more definitive attribution of observed effects to specific alpha-1 adrenergic receptor subtypes.

What are the critical parameters for successful expression and purification of recombinant Alpha-1D adrenergic receptor?

The expression and purification of functional recombinant Alpha-1D adrenergic receptor presents significant technical challenges due to its complex transmembrane structure and specific post-translational requirements. Based on current research, the following parameters are critical for success:

Expression System Selection: The choice of expression system significantly impacts receptor yield and functionality:

Expression SystemAdvantagesConsiderationsRecommended Applications
Mammalian Cells (HEK293, CHO)Native-like post-translational modifications, proper foldingLower yield, higher costFunctional studies, structural analysis
Insect Cells (Sf9, Hi5)Higher expression levels than mammalian cells, eukaryotic processingDifferent glycosylation patternBinding studies, antibody production
E. coliHigh yield, cost-effectiveLack of post-translational modifications, inclusion body formationFragment expression for antibody generation

Membrane Solubilization: The Alpha-1D adrenergic receptor contains seven transmembrane domains that require careful solubilization to maintain native conformation:

  • Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) are preferred

  • Cholesterol supplementation often improves stability

  • Consider nanodiscs or lipid cubic phase systems for maintaining a lipid environment

Protein Engineering Strategies: Several modifications can enhance expression and stability:

  • N-terminal signal sequences to improve membrane targeting

  • Truncation of flexible N- and C-terminal regions while preserving the PDZ ligand interaction site critical for syntrophin binding

  • Addition of fusion partners (T4 lysozyme, rubredoxin) to enhance stability

  • Thermostabilizing mutations identified through alanine scanning

Quality Control Assessments: Rigorous validation ensures properly folded, functional receptor:

  • Radioligand binding assays with [3H]prazosin to confirm ligand binding capacity

  • Size-exclusion chromatography to assess monodispersity

  • Functional assays such as G-protein coupling or β-arrestin recruitment

  • Western blot analysis with specific antibodies targeting the extracellular domain

Protein-Protein Interaction Considerations: The interaction with syntrophin family proteins via the C-terminal PDZ ligand is essential for proper localization and function . Preserving this interaction site or co-expressing with appropriate binding partners may enhance functional expression.

How can researchers address data discrepancies in Alpha-1D adrenergic receptor studies?

Researchers working with Alpha-1D adrenergic receptor may encounter conflicting data across different experimental systems or publications. The following methodological approach helps address these discrepancies:

Source of Variations: Several factors contribute to disparate findings in Alpha-1D adrenergic receptor research:

  • Species Differences: Receptor pharmacology can vary significantly between species. While rat and mouse α1D-AR show high homology, notable differences exist compared to human ADRA1D .

  • Tissue-Specific Effects: The receptor demonstrates different signaling properties and functions depending on the cellular environment. For example, α1D-AR binding capacity was completely lost in the aorta of knockout mice while remaining unaltered in the heart .

  • Experimental Conditions: Differences in experimental conditions, including temperature, pH, and ionic composition of buffers, can significantly impact receptor conformation and ligand binding properties.

  • Protein Interaction Profile: The receptor's interaction with syntrophins and scribble proteins imparts divergent pharmacological properties to the complex , potentially explaining functional variations across experimental systems.

Systematic Reconciliation Approach:

To address these discrepancies, researchers should implement a systematic reconciliation approach:

  • Standardized Characterization Protocol:

    • Establish baseline receptor expression using quantitative RT-PCR and Western blot analysis

    • Confirm receptor functionality through binding studies with [3H]prazosin

    • Validate cellular localization using immunohistochemistry with specific antibodies

  • Cross-Validation Strategy:

    • Test critical findings across multiple experimental systems

    • Compare results between recombinant expression systems and native tissues

    • Validate key findings using both knockout models and pharmacological approaches

  • Protein Interaction Profiling:

    • Assess the presence of known interaction partners like syntrophins and scribble

    • Characterize the effect of these interactions on receptor pharmacology

    • Consider how different expression systems may alter the protein interaction landscape

  • Reporting Standards Enhancement:

    • Document complete experimental conditions including buffer composition, temperature, and incubation times

    • Specify the exact receptor construct used, including any modifications or fusion tags

    • Report both positive and negative results to build a comprehensive understanding

By implementing this systematic approach, researchers can better understand the sources of data discrepancies and develop more consistent experimental paradigms for studying Alpha-1D adrenergic receptor function.

What emerging technologies are advancing Alpha-1D adrenergic receptor research?

Several cutting-edge technologies are transforming our ability to study Alpha-1D adrenergic receptor structure, function, and pharmacology:

Cryo-Electron Microscopy: This revolutionary structural biology technique is overcoming historical challenges in GPCR structural determination:

  • Enables visualization of Alpha-1D adrenergic receptor in complex with binding partners including syntrophins and scribble proteins

  • Reveals conformational changes upon ligand binding without the need for crystallization

  • Provides insights into the unprecedented modular dimeric architecture of the receptor in the cell membrane

CRISPR/Cas9 Gene Editing: Advanced gene editing technologies offer unprecedented precision for receptor studies:

  • Creation of endogenous tagged receptors that maintain native expression levels

  • Development of cell lines with specific point mutations to study structure-function relationships

  • Generation of improved knockout models with tissue-specific or inducible receptor deletion, building upon the initial α1D-/- models

Optogenetics and Chemogenetics: These technologies enable precise temporal control of receptor activity:

  • Light-activated or designer drug-activated versions of Alpha-1D adrenergic receptor

  • Cell-type specific expression systems to study receptor function in defined neural circuits

  • Real-time monitoring of downstream signaling events following receptor activation

Advanced Imaging Techniques:

  • Single-molecule imaging to track receptor movements and interactions in living cells

  • Resonance energy transfer methods (FRET/BRET) to monitor receptor-protein interactions in real-time

  • Super-resolution microscopy to visualize receptor clustering and organization at the nanoscale level, particularly relevant for understanding the receptor's dimeric architecture

Artificial Intelligence and Computational Approaches:

  • Machine learning algorithms to predict ligand binding properties and discover novel compounds

  • Molecular dynamics simulations to study receptor conformational changes and protein-protein interactions

  • Systems biology approaches to integrate receptor signaling into broader physiological contexts

Organoid and Microphysiological Systems:

  • Three-dimensional tissue models incorporating Alpha-1D adrenergic receptor expressing cells

  • Organ-on-chip technologies to study receptor function in physiologically relevant microenvironments

  • Particularly valuable for studying the receptor's role in complex tissues like the urothelium

These emerging technologies complement established methodologies like reporter assay systems and radioligand binding studies , enabling more comprehensive investigation of Alpha-1D adrenergic receptor biology and accelerating the development of subtype-selective therapeutic agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.